DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30275 and CFAP61

Sequence 1:NP_788430.3 Gene:CG30275 FlyBaseID:FBgn0050275 Length:1298 Species:Drosophila melanogaster
Sequence 2:XP_005260745.1 Gene:CFAP61 HGNCID:15872 Length:1242 Species:Homo sapiens

Alignment Length:1296 Identity:282/1297 (22%)
Similarity:519/1297 (40%) Gaps:225/1297 (17%)


  Fly     7 RLAQAGDQDGLNKLIRSPGVKWFGNIRPKFRGKDSLFNSYQTYRILAFCTESSALVAYAEFRNYP 71
            |..::.|...:..|||....|.||.:       :.::...:....:..|.:...::|.|.|.:||
Human    17 RRTESQDVYCIKSLIRKFTCKLFGKL-------NIIYLLEKANLAVTLCNDKEEIMAQATFLDYP 74

  Fly    72 SIAALPTDCWLEWLSTRYCLSMSI--SWLNALFFNFCVYKSDQS-PVLVEIIKDVLYRESRVWFL 133
            :......|   :|:|....|...|  :.||.||.:..|...:.| ....||::.|......:.|:
Human    75 NWNVAKQD---DWVSVFRELDSDIPCTPLNTLFMHLFVAVDEYSVGCCKEILRTVYKAVPELHFI 136

  Fly   134 ITVRCPYVPQPIHFVETFDDLEKISQVFYPLEYSMDKNNNTQSLYIVDRFVILPRITYRKALAED 198
            ..:...|:......:..||.:..|..:.|..::         :::|..|....|::..|||..||
Human   137 FLIVPSYMSLGSTLITVFDQVGNIPCLTYEEDF---------AVHICHRHSHYPQLHVRKARVED 192

  Fly   199 NDDIIAMQEVENPEMREELGDYYIAEEVMGQNPKSMLVVAETINQSQESEMAIFLWLSSDIDIMF 263
            :||::.:....:..::|..|:|::||.:..|:.::..||.|.     |.....|:.:.|.:::..
Human   193 HDDLMPIFMRYDTILKETYGEYFLAELIEAQDEENHAVVCEV-----EGTAVGFMSVCSRVNMQL 252

  Fly   264 YVRNYEMEQFGNLVKPADGRSFHYETMTVS----SVQRRAEASMFTADALDDLNAVTILGGLQKV 324
            ....:::..|..|..|      |.:.:..|    ||:|..:|.:.::..           |.||:
Human   253 LHECFDLGPFHGLCFP------HPDDVLESPQDLSVRRSQDAELRSSSQ-----------GSQKI 300

  Fly   325 DSGMSVASLGKMKVSSIGGTIVDTNVANENKFYMRECLYSKFKYILEKLH--STDYYLRH---EQ 384
            ...:. ..:....:.:|.|.|.....:.|....::....|:.:.| |||.  ||.|...|   .:
Human   301 VEELQ-EPVSPDTMENIQGNIAREAASEEALTAVQSGNVSEPEDI-EKLSDISTGYAQYHHVSSR 363

  Fly   385 SVINFIYPAGTEPAGPAAM---AAASNVFLLRCIVARQDFPLPRLFNAMVAIFSAYPDRDYCMML 446
            |:.:.:.|  .||.....:   |:|:....|.||..:.:   .|..:.|..:||.:.|:::|  :
Human   364 SLASLVLP--EEPVHFRPIYRGASAAFCIQLFCIDEKYE---ARSLDFMNFVFSLFSDKNFC--V 421

  Fly   447 MSVKYKASKSYLEVMQYFMPVASRPSNLSSLD-DVFITHRSTIFGEISLYKLEKEDVAHVHKLAL 510
            :|:.:...:.:|  :|.|:.:.  |.|..:|: |:::.||:.:...|::......|...|.    
Human   422 ISLPHLTPEFFL--IQNFVKMV--PFNTCTLEQDLYVFHRAGLLKSINIRFATLLDTPGVE---- 478

  Fly   511 GNLPSNTQTPNSSSSSFSYCSKVNEREELEHELHVLDAIMKDVLENEFSEFAVFTIRCGISTRSV 575
             ||.|......|........:|.  |::.:..|  |.|.:.:|.|.                   
Human   479 -NLVSTLMLNKSILEDLDRYNKA--RKDPDGTL--LQAFVAEVAEQ------------------- 519

  Fly   576 RENTAIGFVIVREFHSHEKLFEHYHLPKQEYQLNRRRAE---IISLRLHPLFLVSAGLIFRDLAR 637
                .:|..::|.....|.:..||::....|..:.:|.|   :....|:|:|........:::.|
Human   520 ----IVGIAVIRNEMDIEYIRSHYNIEDFIYFSHHQREEHGHMHHFALNPIFRHYTKFFLKEILR 580

  Fly   638 ---KTSFYDYYFIHSVDG--------YKYSNDLKKMMMVVEPKPIKKVPVFTRVQANHKKPRKKL 691
               |:..|...:..|.:|        ..|::.|...:..:.|...::..|:...:.....|.|.:
Human   581 LGFKSCLYYRVYPKSREGKIAVFQFQNPYAHSLTSALHYLVPVRPRRQIVYPLEKLGINAPSKAV 645

  Fly   692 DLPPPNFSRDNLIIYRHKLNPVKWFTNSQKLVIIGFSAVTKAFLRQLVFQWNSKDHKNSENFTCL 756
            ...|.:::.::.   ..||......|.:.|::::|.|:|..:||..|||..:.|       |..|
Human   646 SKDPMSYALNHT---NRKLTLEPKITVNAKIIVVGASSVGISFLETLVFCSHMK-------FNNL 700

  Fly   757 TRLQVTVICRAGIVEADYDSLFKCPYCTNRQGCYLSYRNESCYVRDCCMRIDLRCWVHFVPGKVE 821
            |.:....:....:::.:........:|.|.:...|               :.|..||:.|.|::.
Human   701 TLISTHGLPGKKLLDTEQRKFLASDHCFNDKDYAL---------------MSLCSWVNVVVGRMT 750

  Fly   822 KVDRDKKFVKLDSCEIY-YDTLLLMCDRMFVLRC------------IDVPVYSPR------PCNL 867
            .:||..|.|.|.:.||. ||.|:|...:.:.:.|            .:||..|.|      ||| 
Human   751 GIDRAAKHVVLSTDEIVPYDHLILCTGQQYQVPCPTEADISQHLTNREVPNSSQRRYTGKVPCN- 814

  Fly   868 VEINFRLN------KFLLFYKVRALLEDMPRTYLVLVYGNNLHTYECIAFLIGHGVDCSRMVFVQ 926
               :|.||      |.|::.:..::..:..    ::||||.:.||..:..|:..||..||:..||
Human   815 ---HFTLNEEEDCFKALIWIRNNSITTEGN----IIVYGNTIDTYTTVETLLNLGVSGSRIHLVQ 872

  Fly   927 P---HRITGRDADMKEKCPYWDKNLQMIMDDILVEKGVNIFTDYDFHHYNLHKSTDFIMEVIFQH 988
            |   ..||..:          :.:::..:.|.|...||.::.|.....:|.....|.|....|. 
Human   873 PPPASTITCIN----------NYSVESAVADALGAAGVTMYRDAILAQWNDGLHPDPIYSASFT- 926

  Fly   989 FPTQKQMTFECDLFISFQEGHLHQRHKQWLENAGIELDGNQILVNERYQTNDPDVYAAGSFIKMR 1053
            .|| |....:|.:|.||.|.::.....:.|.:|.:..| ::::::..:.|||..:.||||..|. 
Human   927 TPT-KPFRLQCSMFFSFCEKNVDYETFKALNDACLVYD-SRLVIDTNFHTNDIAIRAAGSLTKF- 988

  Fly  1054 ITPNYQY-------KFVSER---ELARKILHHLGIVTDKNFEDRFAEPVLFQAILPL-------- 1100
              .|..|       .|.|:.   :||..:||    :.|...|.....|.....::|:        
Human   989 --SNRYYSNEWTHSNFSSKEIGFQLAAAMLH----LFDPTLEPVTEPPANLDRLIPMYKGAKIQG 1047

  Fly  1101 -------RYF-ITKVTMPRRYLLSQVPVIKNCNLTT--YKNKTFCRVGLSTRMMVDEIVVVTKKE 1155
                   .|. |.|..:|....:..........|.|  .||.|:.|:.::...||:.|..::::.
Human  1048 GILPGSYHYLHIAKPAIPTPLEVQMAQPNYGLELVTGSAKNGTYFRIHINKYKMVETITCLSREP 1112

  Fly  1156 CNLDFLLYFCGKHELLLNKLKSRYRANLIHCFLKFFQEPWTELIMHDDFEELQAENKELLS 1216
            ......:...|:||.|||.|.:||..|||.....:|.|||...:.||.|.:|:.|.:::|:
Human  1113 FPASNYIRLFGQHEQLLNNLCARYDENLITDLYSYFTEPWCLALFHDRFIDLRKELRQILA 1173

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30275NP_788430.3 DUF4821 5..279 CDD:292710 58/275 (21%)
CFAP61XP_005260745.1 DUF4821 15..268 CDD:318340 58/275 (21%)
NirB 672..>777 CDD:330997 32/127 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C325431317
eggNOG 1 0.900 E1_2CMWM
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 159 1.000 Inparanoid score I4197
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D120508at33208
OrthoFinder 1 1.000 FOG0004774
OrthoInspector 1 1.000 T609265
orthoMCL 1 0.900 OOG5_131204
Panther 1 1.100 LDO PTHR21178
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5804
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1312.800

Return to query results.
Submit another query.