DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30275 and LOC108647660

Sequence 1:NP_788430.3 Gene:CG30275 FlyBaseID:FBgn0050275 Length:1298 Species:Drosophila melanogaster
Sequence 2:XP_017949677.1 Gene:LOC108647660 ID: Length:270 Species:Xenopus tropicalis

Alignment Length:256 Identity:53/257 (21%)
Similarity:108/257 (42%) Gaps:36/257 (14%)


  Fly   956 LVEKGVNIFTDYDFHHYNLHKSTDFIMEVIFQHFPTQ-KQMTFECDLFISFQEGHLHQRHKQWLE 1019
            |:.:|::.:.:.....:|.....|   .:.|..|.:. |.:..:|..|.:|....:.....:.:.
 Frog    19 LLAEGISSYCNCVLAQWNDGAHPD---PICFATFTSDTKPLRLQCSAFFNFSRKSVDYEAFKAIN 80

  Fly  1020 NAGIELDGNQILVNERYQTNDPDVYAAGSFIKMR---ITPNYQYKFVSERELARKILHHLGIVTD 1081
            :|.:..|| :::::..:.|||..:.|||:..|..   ....:.:...|.:|:..::..::..:.|
 Frog    81 DACLVYDG-RLVIDTTFHTNDDSIRAAGTLTKYSNRYHASEWSHSNFSSKEIGFQLAANMLNIFD 144

  Fly  1082 KNFE---------DR----FAEPVLFQAILP--LRYF-ITK--VTMPRRYLLSQVPVIKNCNLTT 1128
            ...|         ||    :..||:...|:|  ..|. :.|  :..|.:..::|....:.....:
 Frog   145 PTLEPVIEFTDEFDRLIPIYKGPVIQGGIIPGGFHYLHVNKPAIPCPLKAQMAQAHYGREIVTGS 209

  Fly  1129 YKNKTFCRVGLSTRMMVDEIVVVTKK---ECNLDFLLYFC--GKHELLLNKLKSRYRANLI 1184
            ..:..:.|:.::...||:.|..:::|   |.|     |.|  |.||.|||.|.:|:...||
 Frog   210 AVDGDYFRLHINQYNMVESITCLSQKPFPESN-----YICLYGHHERLLNNLCARFDEGLI 265

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30275NP_788430.3 DUF4821 5..279 CDD:292710
LOC108647660XP_017949677.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D120508at33208
OrthoFinder 1 1.000 FOG0004774
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.