DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30275 and cfap61

Sequence 1:NP_788430.3 Gene:CG30275 FlyBaseID:FBgn0050275 Length:1298 Species:Drosophila melanogaster
Sequence 2:XP_009293268.2 Gene:cfap61 ZFINID:ZDB-GENE-130530-604 Length:1183 Species:Danio rerio

Alignment Length:1389 Identity:280/1390 (20%)
Similarity:504/1390 (36%) Gaps:368/1390 (26%)


  Fly     6 IRLAQAGDQDGLNKLIRSPGVKWFGNIRPKFRGKDSLFNSYQTYRI-LAFCTESSALVAYAEFRN 69
            :|..:..|.:.:|.||....|..||.:        ::.|..:...: :...:..:.::|:|.|.:
Zfish    16 VRRTEWSDAEEINHLISPASVAVFGRL--------NVINLLEKANLAVTLSSSKNEVLAHASFSD 72

  Fly    70 YPSIAALPTDCWLEWLSTRYCLSMSISW---LNALFFNFCVYKSDQS-----PVLVEIIKDVLYR 126
            :|....:...||...|. .|..:..::.   :|.||....|.:...|     .:...:...|:..
Zfish    73 HPIEELVDQACWQNRLQ-NYASAEKLTVGRPMNTLFLRLFVAQPGFSIGGAKEIFRTVFSAVVEL 136

  Fly   127 ESRVWFLITVRCPYVPQPIHFVETFDDLE-KISQVFYPLEYSMDKNNNTQSLYIVDRFVILPRIT 190
            |.     |.:..||          ...|| .:.::|.|:....|:..  .|.|:..|....||:.
Zfish   137 EH-----ICLLTPY----------GGALEAALQKIFEPMTSVTDEAQ--YSAYVCHRHDHCPRLH 184

  Fly   191 YRKALAEDNDDIIAMQEVENPEMREELGDYYIAEEVMGQNPKSMLVVAETINQSQESEMAIFLWL 255
            .|||..||:||::.:...:...:.|..|.:.::|.:..|..:....|.|:     :..:..|:.:
Zfish   185 IRKARVEDHDDLMHIFGEQITPLVETYGPFVLSELIETQEQEHHTAVCES-----DGAVVGFISV 244

  Fly   256 SSDIDIMFYVRNYEMEQFGNLVK----------------PADGRSFHYETMTVSSVQRRAEASMF 304
            |:.:|:....:.:|:..|..|.|                |||......||......::.||....
Zfish   245 SAHVDLKLLNKCFELGAFEGLTKTDPSQQEEPHQLEEENPADDAQQSDETNEPVEGEQTAEEETA 309

  Fly   305 TADALDDLNAVTILGGLQKVDSGMSVASLGKMKVSSIGGTIVDTNVANENKFYMRECLYSKFKYI 369
            ..|...|::...                                        |...|       |
Zfish   310 GGDQYTDISQTE----------------------------------------YTEPC-------I 327

  Fly   370 LEKLHSTDYYLRHEQSVINFIYPAGTEPAGPAAMAAASNVFLLRCIVARQDFPLPRLFNAMVAIF 434
            .|.:...:                .:||.||      ||.|.::.....:.|.: |..:.:..:|
Zfish   328 KETVDCCE----------------DSEPDGP------SNAFCIQLFTMEKKFEM-RSADFLPYLF 369

  Fly   435 SAYPDRDYCMMLMSVKYKASKSYLEVMQYFMPVASRPSNLSSLDDVFITHRSTIFGEISLYKLEK 499
            ..:|:||:|  ::||..:|:.  ..::|.|:.||.|.:: :...::::.||..:...:.:.....
Zfish   370 KLFPERDFC--VISVPKQAAD--FPLLQSFIRVAPRDTS-TFPQELYLCHRWGLTRRLEVRVAVS 429

  Fly   500 EDVAHVHKLALGNLPSNTQTPNSSSSSFSYCSKVNEREELEHELHVLDAIMKDVLENEFSEFAVF 564
            .|:..|..|.                     ..:::|:.:   :..||..::....::.:....|
Zfish   430 SDIPAVQSLT---------------------ESLSQRDSI---IEDLDLFLQARKNSDGTALQAF 470

  Fly   565 TIRCGISTRSVRENTAIGFVIVREFHSHEKLFEHYHLPKQEYQLNRRRAE---IISLRLHPLFLV 626
            ....        :...:|.:|.|:....|.:..::.:.:..|..:.:|.|   :....|.|:|..
Zfish   471 VAHV--------DGRVVGLIITRDEEDIEFIRANFDIERFMYFSHNQREEHGRLCHFLLSPVFQH 527

  Fly   627 SAGLIFRD---LARKTSFYDYYFIHSVDGYKYSN-----DLKKMMMVVEPK-----PIKKVPV-- 676
            ....|||:   ||.|:..| |......|.||..:     .:...|:.|.|:     |::::.:  
Zfish   528 YTKYIFREVLRLAHKSCLY-YLLPPPHDCYKNVSAHSLTAVLNFMVPVSPRRQIIYPLEELGINA 591

  Fly   677 ----FTRVQANHK--KPRKKLDLPPPNFSRDNLIIYRHKLNPVKWFTNSQKLVIIGFSAVTKAFL 735
                .|::||...  ...:||.:.|.                   .|.:.::|::|.|....|||
Zfish   592 PSQHITKLQAPFALYHTNRKLAMEPK-------------------VTINARIVVVGASDTALAFL 637

  Fly   736 RQLVF----QWNS---------KDHKNSENFTCLTRLQVTVICRAGIVEADYDSLFKCPYCTNRQ 787
            ..|.|    ::|:         .||.:.:   |.|.|..:                   :|.|. 
Zfish   638 EALTFCPHLRFNNLSLISTHALPDHSSDD---CSTFLATS-------------------HCYND- 679

  Fly   788 GCYLSYRNESCYVRDCCMRIDLRCWVHFVPGKVEKVDRDKKFVKL-DSCEIYYDTLLLMCD---- 847
                         ||.| :|.|..|:..|.||::.::|..|.|:| |...:.:|.|:| |.    
Zfish   680 -------------RDQC-QISLCSWISVVTGKIKAINRADKHVELMDDSRVKFDYLIL-CTGLQY 729

  Fly   848 RMFVLRCIDVPVYS----------PR-PCNLVEINFRLN--------KFLLFYKVRALLEDMPRT 893
            :|..|...||...:          || |.||    |.||        ...|.:....|..|    
Zfish   730 QMPNLSNADVITQTSNSLKPKETRPRVPSNL----FLLNDHQDCSVAHHWLTHNFTQLTGD---- 786

  Fly   894 YLVLVYGNNLHTYECIAFLIGHGVDCSRMVFVQPHRITGRDADMKEKCPYWDKNLQMIMDDILVE 958
              .:||||.:..:.||..|||.||...|:..|.|      ..|....| :.|.::::.:...|.:
Zfish   787 --AVVYGNTIDVFTCIETLIGLGVSGRRIHVVHP------PEDQPFSC-FPDASVELAVKQALEK 842

  Fly   959 KGVNIFTDYDFHH------YNLHKSTDFIMEVIFQHFPTQKQMTFECDLFISFQEGHLHQRHKQW 1017
            :.|::      ||      .|..:.|:.:....|.......|:  ||.:|.||....:.....:.
Zfish   843 EEVHV------HHNCLLLQINDGQHTEPVTSASFSTDGAILQL--ECAVFFSFSRKSVDCDAFRA 899

  Fly  1018 LENAGIELDGNQILVNERYQTNDPDVYAAGSFIKMRITPNYQYKFVSE---------RELARKIL 1073
            :.:|.:..|| :::|:..:.||||.:||||...|      |..::.:|         :|:.:.:.
Zfish   900 INDACLVFDG-RLVVDSGFHTNDPSIYAAGPMTK------YSRRYHAEEWSHCCFQSKEVGQSLA 957

  Fly  1074 HHLGIVTDKNFEDRFAEPVLFQAILPLRYFITKVTMPR-----RYLLSQVPVI-------KNCNL 1126
            ..|....|...|.....|.....::|| |...|....|     .||....||.       |..:|
Zfish   958 SVLLAQCDPTLERPVDPPPDQLHLIPL-YSQAKTQGGRLPGGYNYLHVAKPVARKTPSAHKGRDL 1021

  Fly  1127 TTYKNKT--FCRVGLSTRMMVDEIVVVTKKECNLDFLLYFCGKHELLLNKLKSRYRANLIHCFLK 1189
            .|...:|  :..:..|...:|::|..::|....:..|....|||:.|||.:.|||...||.....
Zfish  1022 VTGCAETGNYFHIRHSQFDVVEKITCLSKTPLPVSNLQSLYGKHQRLLNNICSRYDEGLIQDMYS 1086

  Fly  1190 FFQEPWTELIMHDDFEELQAENKELLSPMAISALSRPGRG------ALGELTD-----------M 1237
            :|:|.|...:.||.|.:.:.|..:::.    ||..:...|      ||.::.|           .
Zfish  1087 YFKENWCLALYHDRFADFEQEVCQIMD----SAKLQDESGSVSLEEALQQIADDKAESDQLVSLS 1147

  Fly  1238 DFFTLNKRYIELK--LLTFLREHR 1259
            ..|..::.|..|:  :|.:|:.:|
Zfish  1148 QTFQKSQAYSALRNSVLDYLKYNR 1171

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30275NP_788430.3 DUF4821 5..279 CDD:292710 57/299 (19%)
cfap61XP_009293268.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D120508at33208
OrthoFinder 1 1.000 FOG0004774
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.