DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS1 and Y19D10A.11

DIOPT Version :9

Sequence 1:NP_726254.1 Gene:MFS1 / 246519 FlyBaseID:FBgn0050272 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_001303757.1 Gene:Y19D10A.11 / 189488 WormBaseID:WBGene00021226 Length:465 Species:Caenorhabditis elegans


Alignment Length:472 Identity:111/472 - (23%)
Similarity:188/472 - (39%) Gaps:93/472 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 TFLLFLSIVVNYMAKFNAGVAVVAMTN-AENTN--PNFPEYDWNE--MERSYILSSFFWGYILTQ 77
            ||:...::..|:        .|:.|.: .|:.|  .|:.:..|.|  .|:|.:.|....|.::..
 Worm    41 TFIQMNTLTFNF--------TVICMEDIVEDYNLLTNYTDTHWFERNTEKSLLFSGAAIGGLIGL 97

  Fly    78 FMGGWLCRRYGARITMFVSTIGSALLVVLIPWCVSWGGWQAYCAIRMSMGLFQGFLFPCIHAHLA 142
            .....|....|......:|.|.||....|.|..||.|.:.:... |:..|:....:|..:.....
 Worm    98 IPAVPLISSLGLGNVQTISGIISAFGAFLFPLAVSIGFYTSLLC-RILQGVGSAIMFTTVGVVPG 161

  Fly   143 NWCPVKERNRLGALANTGIDCGTLVAMFASGLLAASSIGWPGIFYVSCGVGVLWCIVWWIFGANQ 207
            .|.|..|.|...|:.:..:....::.|..||||..|::||..|:|:..|:..:..||:|...::.
 Worm   162 VWAPSNEANTFMAILSCALQLSNIICMPVSGLLCESALGWRSIYYLFGGLTFIIYIVFWFTYSDD 226

  Fly   208 PRESKFIGEAELNYIETSINSSRKAEEAELKATGPIPVPWKAI---------WTS-----VPFWA 258
            |:..:.:.:.||..|.|  ....|.:|         |||:.||         |||     :.|:|
 Worm   227 PKLHRNVSQKELGKIST--GKIEKIKE---------PVPYLAICTDPTVLITWTSCFGGNMAFFA 280

  Fly   259 LMVTRCCQSWGYSTLQTEMPAYMNGVLLMDMKSNALYSALPYLTSWVMAFVYLIIADILLTRGIM 323
            |.:      :|        |.|:..:|..|::.....||||::.|.::.|            |..
 Worm   281 LSL------YG--------PTYLREILKFDVRETGFLSALPFILSAIVKF------------GAG 319

  Fly   324 SITGIRKSVNSIAFFVPAAALIGVSFLDNTQKTLAVVLMC-------ANVGIN-----AGSTIGS 376
            .::.....::..|.||..||...:.|      .:.:|:|.       |.:..|     :|..|..
 Worm   320 QLSDRMTFLSEKARFVFFAATSQIGF------AVGLVVMAFTSDRLIAQIAFNFAIVSSGLNIMG 378

  Fly   377 TINTIDL-SPNHAGILMGIVNTASNIVPILTPLLVGIIVKDDHDREQWQI--VFIISAVIFCVGN 438
            .|..|.| ...|....:.:::..:.:|..|.|::|.||. .|:..|||.|  :||...:|.|...
 Worm   379 VIKCIQLRCRQHVHFAIAVISFTAYVVQFLAPIIVSIIC-PDNTPEQWTILFLFITGVIIVCNAG 442

  Fly   439 IVYV------AFGKMVN 449
            ..::      |:.|.:|
 Worm   443 FPFITRSDPAAYTKQIN 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS1NP_726254.1 MFS 18..444 CDD:119392 108/465 (23%)
2A0114euk 19..456 CDD:129972 110/471 (23%)
Y19D10A.11NP_001303757.1 MFS 81..443 CDD:391944 98/406 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.