DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30203 and spon2

Sequence 1:NP_725128.2 Gene:CG30203 FlyBaseID:FBgn0050203 Length:924 Species:Drosophila melanogaster
Sequence 2:NP_001072560.2 Gene:spon2 XenbaseID:XB-GENE-945214 Length:326 Species:Xenopus tropicalis

Alignment Length:321 Identity:98/322 (30%)
Similarity:137/322 (43%) Gaps:41/322 (13%)


  Fly   166 ELNSLTPPLE-TCCACDE-AKYEIVLERKWARNTHWKDF----PSEDWRTRLGEVIGASHSHSYR 224
            |.:|..|..| :.|..:| |||.||...||.:.:..|.:    |...|.|    ::|.:||..|.
 Frog    19 EYSSCLPLSEDSICTAEEIAKYSIVFTGKWTQASFPKQYPLYRPPAQWST----LLGVTHSSDYH 79

  Fly   225 YWAYGGRASKGMKELAEHGATRTLENEIR---ENTQNGEVRTIIKAPGIPYRPKTFGTTLANARL 286
            .|.....||.|:::.||.|....|..||.   |..|:  |..|.....|     :.||..|:...
 Frog    80 MWKKLEPASNGVRDFAEKGEAWPLMKEIETAGEKIQS--VHGIFSTASI-----SGGTGQASTEF 137

  Fly   287 D--PVHHQISLAAKIDPSPDWILGVAGLELCLSNCTWLERKVLNLYPWDIGTDSGPSYMSSDEPQ 349
            :  ..|..:|...:|.|||||.:||..|.|| ....|.:...|.|:|:|.|||||.::.|.:...
 Frog   138 EAHSRHPFVSFMVRIVPSPDWFVGVDTLNLC-EGKHWKQTATLELHPYDAGTDSGFTFSSPNFAT 201

  Fly   350 VPPDVVRRITSSYPSDHRSPFYDDTGAPMKPLATLYLTRKKLYI--------------RECEEVP 400
            :|..:|..||:|.||...:.||......:.|:|.:..|:.|..:              .|..|..
 Frog   202 IPQGIVTEITASSPSHPANSFYYPRLKSLPPIAKVVFTKVKGRLSSFLDIVSNVTTTGNEIAEHI 266

  Fly   401 QEGPLECAVHPWNEWTNCSTRCG-QGYSHRQRSFK-NPNLAANFNCDRRLEEFRQCQGTQC 459
            .|.||:|.|..|:.|..|...|| .|...|.|..: .|  |.|......|.|.::|....|
 Frog   267 LETPLDCEVSVWSSWGLCRGSCGTAGVKSRTRYIRLKP--ANNGTACPALNEDKECDPENC 325

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30203NP_725128.2 Reeler 18..160 CDD:260081
Spond_N 183..372 CDD:283999 66/198 (33%)
TSP1 411..459 CDD:214559 14/50 (28%)
TSP1 492..541 CDD:214559
KU <739..773 CDD:197529
spon2NP_001072560.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3539
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D240419at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.