DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30203 and spint2

Sequence 1:NP_725128.2 Gene:CG30203 FlyBaseID:FBgn0050203 Length:924 Species:Drosophila melanogaster
Sequence 2:NP_001039077.1 Gene:spint2 XenbaseID:XB-GENE-947329 Length:394 Species:Xenopus tropicalis

Alignment Length:235 Identity:54/236 (23%)
Similarity:76/236 (32%) Gaps:80/236 (34%)


  Fly   653 KLVGNRPGYNDFN----------SDYNNKD-----AYNDYTTPSFTS---RTPFGSRY---PNQQ 696
            ||:|..  |:.||          ..|..||     ...|:..|...:   |..| .|:   ||.|
 Frog    81 KLIGCL--YSGFNMCELESKEGTRSYRRKDIGPTPTLKDFCLPEAVTGPCRAAF-ERWWYNPNTQ 142

  Fly   697 ETVEGNTNDINGNYN--VVQDYCFEKPYAST-------LP-------------CFAKPVV---ES 736
            ...........||.|  :.::.|..|....|       ||             |..|.|:   .:
 Frog   143 TCENFTYGGCKGNLNNHIGEEVCMNKCAGVTAEMSNDILPPSKRMAEANSDPACTGKGVIGNCRA 207

  Fly   737 NY--WFYDHEDHECKIFTTDNCDQNRNRFRTLTACEGTCL----QP---QINMERSEND---AMD 789
            ::  |::|.|...|..||...|....|..:::..|...|:    :|   |..|..|.::   |..
 Frog   208 SFPRWYFDAESQNCISFTYGGCGGTENNHKSVQECADRCIVSKPEPAKVQAPMTGSFSEYCAAPS 272

  Fly   790 LYG------RRSYDQKQTRGRPYDQTS----GIAYGQTEG 819
            |.|      ||.|         ||.|:    ...||...|
 Frog   273 LTGPCRASFRRWY---------YDVTTATCVAFTYGGCRG 303

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30203NP_725128.2 Reeler 18..160 CDD:260081
Spond_N 183..372 CDD:283999
TSP1 411..459 CDD:214559
TSP1 492..541 CDD:214559
KU <739..773 CDD:197529 9/34 (26%)
spint2NP_001039077.1 MANEC 19..104 CDD:323483 6/25 (24%)
Kunitz_BPTI 118..169 CDD:278443 12/52 (23%)
KU 194..247 CDD:238057 13/53 (25%)
KU 266..318 CDD:238057 12/48 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3539
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.