DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30203 and Spon1

Sequence 1:NP_725128.2 Gene:CG30203 FlyBaseID:FBgn0050203 Length:924 Species:Drosophila melanogaster
Sequence 2:NP_742064.1 Gene:Spon1 RGDID:619918 Length:807 Species:Rattus norvegicus

Alignment Length:643 Identity:195/644 (30%)
Similarity:302/644 (47%) Gaps:109/644 (17%)


  Fly    17 GVCNRIPQGASGPRSPVDDNFKILIDGNPETYVPEHQYNVSLSCPINMKFVSFTLVVEAEDPSAA 81
            |.|:||.: |.|.|......|.:.::|:|:.|.|...|.|:||......|..|||:...|:....
  Rat    42 GYCSRILR-AQGTRREGYTEFSLRVEGDPDFYKPGSSYRVTLSAAPPSYFRGFTLIALKENREGD 105

  Fly    82 FGGQDMTGHFELLGVGDTRFSTSCENMVENTNTNAKIYIAVSWIAPRNPDSGCVLIKAGVVQHRD 146
             ..:|..|.|:::...:|:|.::|...|..:....:..|.|.||||.. .:|||::||.:||.|.
  Rat   106 -KEEDHAGTFQIIDEEETQFMSNCPVAVTESTPRRRTRIQVFWIAPPT-GTGCVILKASIVQKRI 168

  Fly   147 VWFLDDGFLTKRICPEEIDELNSLTP-PLETCCACDEAKYEIVLERKWARNTHWKDFP--SEDWR 208
            ::|.|:|.|||::| |:...|:.:|. |:..||||..|||.:.....|:..||.||:|  :..| 
  Rat   169 IYFQDEGSLTKKLC-EQDPTLDGVTDRPILDCCACGTAKYRLTFYGNWSEKTHPKDYPRRANHW- 231

  Fly   209 TRLGEVIGASHSHSYRYWAYGGRASKGMKELAEHGATRTLENEIRENTQNGEVRTIIKA----PG 269
               ..:||.|||.:|..|.|||.||:|:|::||.|:...:|.|||:  |:.||.|:|||    |.
  Rat   232 ---SAIIGGSHSKNYVLWEYGGYASEGVKQVAELGSPVKMEEEIRQ--QSDEVLTVIKAKAQWPS 291

  Fly   270 IPYRP-KTFGTTLANARLDPVHHQISLAAKIDPSPDWILGVAGLELCLSNCTWLERKVLNLYPWD 333
              ::| .......|...:|...|.:|....:.|||||.:|::..:||...|.|:::.|.:|.|||
  Rat   292 --WQPVNVRAAPSAEFSVDRTRHLMSFLTMMGPSPDWNVGLSAEDLCTKECGWVQKVVQDLIPWD 354

  Fly   334 IGTDSGPSYMSSDEPQVPPDVVRRITSSYPSDH-RSPFYDDTGAPMKPLATLYLTRKKLYIRECE 397
            .|||||.:|.|.::|.:|.:.:|.:||   .|| :|||||..|..:..:|.:.:.|......:|.
  Rat   355 AGTDSGVTYESPNKPTIPQEKIRPLTS---LDHPQSPFYDPEGGSITQVARVVIERIARKGEQCN 416

  Fly   398 EVP-----------------QEGPLECAVHPWNEWTNC-STRCGQGYSHRQRSFKNPNLAANFNC 444
            .||                 .:.|..|....|:.|:.| |:.|.:|...|||..| ..|..:..|
  Rat   417 IVPDNVDDIVADLAPEEKDEDDTPETCIYSNWSPWSACSSSTCEKGKRMRQRMLK-AQLDLSVPC 480

  Fly   445 DRRLEEFRQCQGTQCGAAEEELEGEEPGLGMENPPSSGSMAECQLTNWGEWSPCTKTCGRGSSTR 509
            . ..::|:.|.|..|        .:|.|            :.|.::.|..||||:.:||.|  .|
  Rat   481 P-DTQDFQPCMGPGC--------SDEDG------------STCTMSEWITWSPCSVSCGMG--MR 522

  Fly   510 TRDYYNPQARQRCLSVMRIPLEETREC-IGSDCGGT---IPDNGELDGFPEPDVFGETDHGGYMG 570
            :|:.|..|..:.. ||..:|.|||.:| :..:|..:   :.:.||.|.               ..
  Rat   523 SRERYVKQFPEDG-SVCMLPTEETEKCTVNEECSPSSCLVTEWGEWDD---------------CS 571

  Fly   571 KTTSWNSKQEHSSL------GSGNQAWNRK-----------------PYNSWKDKSLS 605
            .|.....|:.|..:      ||..:|...:                 |::.|.|.|::
  Rat   572 ATCGMGMKKRHRMVKMSPADGSMCKAETSQAEKCMMPECHTIPCLLSPWSEWSDCSVT 629

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30203NP_725128.2 Reeler 18..160 CDD:260081 47/142 (33%)
Spond_N 183..372 CDD:283999 77/197 (39%)
TSP1 411..459 CDD:214559 15/49 (31%)
TSP1 492..541 CDD:214559 19/50 (38%)
KU <739..773 CDD:197529
Spon1NP_742064.1 Reeler 43..182 CDD:260081 47/142 (33%)
Spond_N 205..392 CDD:283999 78/198 (39%)
TSP_1 446..494 CDD:278517 15/50 (30%)
TSP_1 505..554 CDD:278517 19/52 (37%)
TSP_1 562..610 CDD:278517 9/63 (14%)
TSP_1 618..665 CDD:278517 4/13 (31%)
TSP_1 672..720 CDD:278517
TSP_1 758..807 CDD:278517
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 396 1.000 Inparanoid score I1864
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D240419at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11311
Phylome 1 0.910 0.667 Consistency score
TreeFam 00.000 Not matched by this tool.
44.070

Return to query results.
Submit another query.