DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30203 and spon1b

Sequence 1:NP_725128.2 Gene:CG30203 FlyBaseID:FBgn0050203 Length:924 Species:Drosophila melanogaster
Sequence 2:XP_005174403.1 Gene:spon1b ZFINID:ZDB-GENE-000427-10 Length:804 Species:Danio rerio

Alignment Length:726 Identity:218/727 (30%)
Similarity:315/727 (43%) Gaps:161/727 (22%)


  Fly     5 IVLLILL------------------SSEVRGVCNRIPQGASGPRSPVDDNFKILIDGNPETYVPE 51
            :|||:.|                  |....|.|..:...|...|....:.|::.::|.||||.|.
Zfish     8 VVLLVFLNVFLIHSDAFKRDTAERHSRSEGGFCRILRTQARSARRDGQNEFRLKVEGEPETYQPG 72

  Fly    52 HQYNVSLSCPINMKFVSFTLVVEAEDPSAAFGGQDMTGHFELLGVGDTRFSTSCENMVENTNTNA 116
            ..|.|||.......|..|||:...|..... ...|..|.|:|:...||:|.|:|...|..:....
Zfish    73 STYRVSLYASSPSYFRGFTLIALKEGREGV-SPDDYAGTFKLIDESDTQFMTNCPPAVTESIPRR 136

  Fly   117 KIYIAVSWIAPRNPDSGCVLIKAGVVQHRDVWFLDDGFLTKRICPEEIDELNSLTPPLETCCACD 181
            :..|.|.|.||.: .||||.:||.|||.|.::|.|:|.||||:|  |.|.:.....|.:.||||.
Zfish   137 RTRIQVFWTAPPS-GSGCVTLKASVVQRRIIFFQDEGSLTKRLC--EKDPVAITEKPAQECCACG 198

  Fly   182 EAKYEIVLERKWARNTHWKDFP--SEDWRTRLGEVIGASHSHSYRYWAYGGRASKGMKELAEHGA 244
            .|||.:.....|:...|.||:|  :..|    ..:|||||:.||..|.|||.||:|:|:::|:|:
Zfish   199 TAKYRVTFYGNWSEKLHPKDYPRRANHW----SALIGASHTRSYVLWEYGGFASEGVKQVSEYGS 259

  Fly   245 TRTLENEIRENTQNGEVRTII--KAPGIPYRPKTF-GTTLANARLDPVHHQISLAAKIDPSPDWI 306
            ...:|.|||:  :..:|.|:|  ||....::|... ....|...:|.|.|.:|....:.|||||.
Zfish   260 PVKMEEEIRQ--KGDDVMTVIKTKAQWPAWQPLNIRAAPSAEFSVDRVRHLMSFLTMLGPSPDWN 322

  Fly   307 LGVAGLELCLSNCTWLERKVLNLYPWDIGTDSGPSYMSSDEPQVPPDVVRRITSSYPSDH-RSPF 370
            :|::|.:||..:|.|:::.|.:|.|||.|||||.||.|.::|.:|.:.:|.:||   .|| :|||
Zfish   323 VGLSGEDLCTRDCGWVQKLVKDLVPWDAGTDSGVSYESPNKPSIPQERIRPLTS---LDHPQSPF 384

  Fly   371 YDDTGAPMKPLATLYLTRKKLYIRECEEVP---------------QEG---PLECAVHPWNEWTN 417
            ||.:|.||.||..:.:.|......:|..||               :||   |..|....|:.|:.
Zfish   385 YDPSGGPMTPLGRVVVERIARKGEQCNTVPDTIDDIVADIAQEEKEEGDNTPETCIYSNWSPWSA 449

  Fly   418 C-STRCGQGYSHRQRSFK---NPNLAANFNCDRRLEEFRQCQGTQCGAAEEELEGEEPGLGMENP 478
            | |:.|.:|...|||..|   :|||..     ...::|..|.|..|  :|||             
Zfish   450 CSSSTCDKGRRMRQRMLKAQLDPNLPC-----LHTQDFEPCMGPGC--SEEE------------- 494

  Fly   479 PSSGSMAECQLTNWGEWSPCTKTCGRGSSTRTRDYYN--PQARQRCLSVMRIPLEETRECIGSDC 541
                 .:.|.::.|..||||:.:||.|..:|.| |..  |:....|    .:|.|||.:|:.:| 
Zfish   495 -----ASTCMMSEWISWSPCSASCGMGMRSRER-YVKQFPEDGSSC----TLPTEETEKCVVND- 548

  Fly   542 GGTIPDNGELDGFPEPDVFGETDHGGYMGKTTSWNSKQEHS-SLGSGNQAWNR------------ 593
                      |..|...|            .|.|...:..| |.|.|.:...|            
Zfish   549 ----------DCSPSSCV------------VTEWGEWEPCSVSCGLGMRRRERMMKMDASDGSPC 591

  Fly   594 ----------------------KPYNSWKDKSLS-----NPRDNAQESPNLP------FDQIENP 625
                                  .|::.|.:.|:|     ..|....::|..|      .:|:|..
Zfish   592 RVQMAEAEKCMMPECNAVVCMLSPWSDWGECSVSCGVGMRTRQRMLKTPVKPGQCPDELEQVEKC 656

  Fly   626 QRPAYNPSDNM 636
            ..|.. |:|.|
Zfish   657 MLPEC-PTDCM 666

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30203NP_725128.2 Reeler 18..160 CDD:260081 51/142 (36%)
Spond_N 183..372 CDD:283999 76/195 (39%)
TSP1 411..459 CDD:214559 16/52 (31%)
TSP1 492..541 CDD:214559 19/51 (37%)
KU <739..773 CDD:197529
spon1bXP_005174403.1 Reeler 50..179 CDD:260081 49/131 (37%)
Spond_N 200..387 CDD:283999 77/196 (39%)
TSP_1 442..490 CDD:278517 16/53 (30%)
TSP_1 501..546 CDD:278517 18/50 (36%)
TSP_1 558..606 CDD:278517 7/48 (15%)
TSP_1 614..661 CDD:278517 10/47 (21%)
TSP_1 668..716 CDD:278517
TSP1 756..804 CDD:214559
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3539
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 393 1.000 Inparanoid score I1891
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D240419at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_132084
Panther 1 1.100 O PTHR11311
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.