DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30203 and mspo

Sequence 1:NP_725128.2 Gene:CG30203 FlyBaseID:FBgn0050203 Length:924 Species:Drosophila melanogaster
Sequence 2:NP_001286427.1 Gene:mspo FlyBaseID:FBgn0020269 Length:601 Species:Drosophila melanogaster

Alignment Length:574 Identity:126/575 (22%)
Similarity:206/575 (36%) Gaps:176/575 (31%)


  Fly   100 RFSTSCENMVENTNTNAKIYIAVSWIAPRNPDSGCVLIKAGVVQHRDVWFLDDGFLTKRICPEEI 164
            :|:....|:..|:|.|                             |:.::.||        |..:
  Fly    64 KFAAEHGNLNSNSNLN-----------------------------RNYYYTDD--------PSPV 91

  Fly   165 DELN---SL-TPPL-----ETCCACDE-AKYEIVLERKWARNTHWKDFPSEDWR--TRLGEVIGA 217
            ..||   || |||.     :|.|..|. |.|::||...|.|....|.:|  |||  .:..:.:|.
  Fly    92 SNLNPTASLATPPATQPAPQTGCTLDRLAVYKVVLHTYWTRELFPKHYP--DWRPTAQWTKTLGR 154

  Fly   218 SHSHSYRYWAYGGRASKGMKELAEHGATRTLENEIRENTQ---------------NGEV------ 261
            :|:.:|..:..|..|:..:|:.||.|.|..|::...|..|               :|.:      
  Fly   155 THNANYALYHIGQPATAAVKQFAESGRTDLLDSNAGEQQQVQMQLQSQMQAGKSPSGGISSGTTS 219

  Fly   262 ---------------------------------RTIIKAPGIPYRPKTFGTTLANARLDPVHHQI 293
                                             |::.....:|..|...|.:.|...:|..|..:
  Fly   220 FNATAASTATPTGGSGGSGGSGGSGGTGTTTAERSVFDEFSMPAIPMGAGRSEAKVFVDSNHSLV 284

  Fly   294 SLAAKIDPSPDWILGVAGLELCLSNCTWLERKVLNLYPWDIGTDSGPSYMSSDEPQVPPDVVRRI 358
            ||..:|.|||||.:||...|||:.. :|::...:.|.|.|.|||:|.::.:.:.|..|..|:.||
  Fly   285 SLMTRIVPSPDWFIGVDSFELCVGG-SWIDTVTVELDPLDAGTDNGFTFTAPNWPTEPQGVIYRI 348

  Fly   359 TSSYPSDHRSPFYDDTGAPMKPLATLYLTRKKLY-----------IRECEEVPQEGPLECAVHPW 412
            ||.||......||......:.|:||....:.|.|           .|:.|.|..:..|: |.|..
  Fly   349 TSRYPGHPAGSFYYPKSKRLPPIATFQFIKLKEYELSEVFNIAEDDRKYETVQTQTHLD-AEHNH 412

  Fly   413 NEWTN------------CSTRCGQGYSHRQR------SFKNPNLAANFNC--------------D 445
            .|..|            ...:..|....|||      :..||...:|.:.              |
  Fly   413 VEMNNELSASIERERQTEQQQLQQNDDERQRIRSQLLAKMNPIYGSNNSLQPAPGQVVSVVPKND 477

  Fly   446 RR--LEEFRQCQGTQCGAAEEELEGEEP--------------GLGMENPPSSGSMAECQLTNWGE 494
            :.  |:...........|::.......|              |.......|:....:|::::|.|
  Fly   478 KHAILQSIASSYRRAADASDANASKPTPSAIGGGKAGGAVGGGAATRRRSSAQRRRDCRVSHWSE 542

  Fly   495 WSPCTKTCGRGSSTRTRDY--YNPQARQRCLSVMRIPLEETRECIGSD--CGGT 544
            |:.|:|:||.|...|.|..  :..:..::|.:     |::::.| |::  |.|:
  Fly   543 WTACSKSCGVGEMHRYRKVIKHGKRGGRQCPA-----LQQSKWC-GTERNCHGS 590

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30203NP_725128.2 Reeler 18..160 CDD:260081 8/60 (13%)
Spond_N 183..372 CDD:283999 64/245 (26%)
TSP1 411..459 CDD:214559 11/82 (13%)
TSP1 492..541 CDD:214559 14/53 (26%)
KU <739..773 CDD:197529
mspoNP_001286427.1 Spond_N 120..363 CDD:283999 64/246 (26%)
TSP1 537..588 CDD:214559 15/57 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C105293564
eggNOG 1 0.900 E1_KOG3539
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D240419at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11311
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.