DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30203 and CG30046

Sequence 1:NP_725128.2 Gene:CG30203 FlyBaseID:FBgn0050203 Length:924 Species:Drosophila melanogaster
Sequence 2:NP_001286341.1 Gene:CG30046 FlyBaseID:FBgn0050046 Length:839 Species:Drosophila melanogaster

Alignment Length:892 Identity:354/893 (40%)
Similarity:487/893 (55%) Gaps:118/893 (13%)


  Fly     5 IVLLILLSSEVRG-----VCNRIPQGASGPRSPVDDNFKILIDGNPETYVPEHQYNVSLSCPINM 64
            :|.|:||.|.|.|     :|.|.|.....|:||||:||.|.:.||||||:...:|||||:.....
  Fly     9 LVELLLLGSLVIGRVSSLICTRRPANTGSPKSPVDENFMISVSGNPETYILGQEYNVSLNAFNGH 73

  Fly    65 KFVSFTLVVEAEDPSAAFGGQDMTGHFELLGVGDTRFSTSCENMVENTNTNAKIYIAVSWIAPRN 129
            :::||.:.:|.|  :..|...|..|.|||..:.:||||.:|.|||||||||:|.::.::|:||..
  Fly    74 RYISFIMALENE--NGDFSYNDDLGRFELSDLIETRFSPNCINMVENTNTNSKTHMHLTWVAPSE 136

  Fly   130 PDSGCVLIKAGVVQHRDVWFLDDGFLTKRICPEEIDELNSL-TPPLET---CCACDEAKYEIVLE 190
            |.||||||:|.|.|||:||.:|||.||||||.|..|::.|. |.|...   |||||||:||::.|
  Fly   137 PGSGCVLIRATVQQHREVWHMDDGGLTKRICEEVTDDVESQPTAPAAVDVPCCACDEARYELIFE 201

  Fly   191 RKWARNTHWKDFPSEDWRTRLGEVIGASHSHSYRYWAYGGRASKGMKELAEHGATRTLENEIREN 255
            ..|:||.|.||||:..|.||..|::||:||..||:|..|..||..|||.|||.::|.||.|...|
  Fly   202 GVWSRNLHPKDFPTRGWETRFCELLGAAHSSDYRFWESGELASVAMKEYAEHCSSRLLEREFSIN 266

  Fly   256 TQNGEVRTIIKAPGIPYRPKTFGTTLANARLDPVHHQISLAAKIDPSPDWILGVAGLELCLSNCT 320
            .::.::||||||.| |..|.....|:|:.|:||:||.:|.|:||:||||||:||.||||||.|||
  Fly   267 FRDQKIRTIIKARG-PSYPNISSKTMASVRVDPIHHMVSFASKIEPSPDWIVGVTGLELCLRNCT 330

  Fly   321 WLERKVLNLYPWDIGTDSGPSYMSSDEPQVPPDVVRRITSSYPSDHRSPFYDDTGAPMKPLATLY 385
            |:|.||:||||||:||||||:|.|||:|||||||:||:.|.:|:|.||||||.:|.||||:|.|.
  Fly   331 WMEEKVINLYPWDVGTDSGPTYTSSDQPQVPPDVIRRMRSDFPNDPRSPFYDISGTPMKPMAILT 395

  Fly   386 LTRKKLYIRECEEVPQEG----PLECAVHPWNEWTNCSTRCGQGYSHRQRSFKNPNLAANFNCDR 446
            :.|:::|.|.|.:.....    |.||..|||:.|::||::||.|..:|:|.:|.|.||..:||:.
  Fly   396 VKRQRIYERRCADEDSNNDPDVPRECFTHPWSSWSDCSSKCGVGMQYRRRVYKQPELARVYNCNE 460

  Fly   447 RLEEFRQCQGTQCG-----AAEEELEGEEPG---LGMENPPSSGSMAECQLTNWGEWSPCTKTCG 503
            ...|.|:|||..||     ...||.|..||.   :|.:  ||....|||:|::||.||||:.|||
  Fly   461 AQYEERECQGEMCGQNNLMREPEEFEDLEPDPRRIGYQ--PSQQRRAECELSSWGSWSPCSVTCG 523

  Fly   504 RGSSTRTRDYYNPQARQRCLSVMRIPLEETRECIGSDCGGTIPDN--------------GELDG- 553
            .|...|.|.|.||||...|..|.|:.|:|||:|.|.||.|::|.:              |.:.| 
  Fly   524 DGYEMRQRQYLNPQAEFDCQGVHRMELQETRKCSGRDCLGSLPGSYSTDMDSPYGGASPGRIGGN 588

  Fly   554 ------FPEPDVFGETD--HGGYMGKTTSWNSKQEHSSLGS-GNQAWNRKPYNSWKDKSLSNP-- 607
                  .||.:.||:.|  ..|.:|.....|.|      |: ||.|.||:. |..:|.....|  
  Fly   589 MYGPQLEPEAENFGDYDDSRNGAVGGFEVGNLK------GNIGNWALNRQT-NLGRDVPSLRPTN 646

  Fly   608 ----RDNAQESPNLPFDQIENPQRPAYNPSDNMGGYDKGFPPTNSYSN----DKLVGNRPGYNDF 664
                |..|::|....:.....|..|.....:....:.:  .|:|.|.:    .::|..|..:...
  Fly   647 YDRARQQAEKSERTTWSGQSRPDDPRLEDVERAPWHRQ--RPSNKYGSIVEAPEMVSPREPWQRA 709

  Fly   665 NSDYNNKDAYNDYTTPSFTSRTPFGSRYPNQQETVEGNTNDINGNYNVVQDYCFEKPYASTLPCF 729
            | ::.|.|.|           ||.|...|:.             :|.     ||:....:...|.
  Fly   710 N-NFGNPDMY-----------TPGGDVDPSL-------------SYR-----CFQMVQTAQPRCH 744

  Fly   730 AKPVVESNYWFYDHEDHECKIFTTDNCDQNRNRFRTLTACEGTCLQPQINMERSENDAMDLYGRR 794
            .: .:..::|||:....||.::..|.||:|.|:||....|| .|.||               |..
  Fly   745 DQ-TITGHFWFYNFCADECMLYAADQCDRNVNKFRRWEDCE-KCRQP---------------GMA 792

  Fly   795 SYDQKQTRGRPYDQTSGIAYGQTEGRSYDQKVGKSYDRTFGRSYKQT 841
            :..|:.|.....:....|  .|.|.|:.::|...:..|.:|.|..:|
  Fly   793 ALQQEHTNSPQCEDFRAI--WQAEQRAREEKRPSNRRRNYGDSRYRT 837

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30203NP_725128.2 Reeler 18..160 CDD:260081 72/142 (51%)
Spond_N 183..372 CDD:283999 111/189 (59%)
TSP1 411..459 CDD:214559 21/48 (44%)
TSP1 492..541 CDD:214559 27/49 (55%)
KU <739..773 CDD:197529 14/34 (41%)
CG30046NP_001286341.1 Reeler 28..167 CDD:260081 72/141 (51%)
Spond_N 194..382 CDD:283999 111/189 (59%)
TSP1 425..473 CDD:214559 21/48 (44%)
TSP1 510..561 CDD:214559 27/51 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C314607987
eggNOG 1 0.900 E1_KOG3539
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 393 1.000 Inparanoid score I1891
Isobase 1 0.950 0 Normalized mean entropy S5564
OrthoDB 1 1.010 D240419at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_132084
Panther 1 1.100 P PTHR11311
RoundUp 00.000 Not matched by this tool.
76.840

Return to query results.
Submit another query.