DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30203 and spon2a

Sequence 1:NP_725128.2 Gene:CG30203 FlyBaseID:FBgn0050203 Length:924 Species:Drosophila melanogaster
Sequence 2:NP_571082.1 Gene:spon2a ZFINID:ZDB-GENE-990415-160 Length:334 Species:Danio rerio

Alignment Length:298 Identity:91/299 (30%)
Similarity:135/299 (45%) Gaps:20/299 (7%)


  Fly   177 CCACDEAKYEIVLERKWARNTHWKDFPSEDWRTRLGEVIGASHSHSYRYWAYGGRASKGMKELAE 241
            |.|...|.|.:|....|:..|..|.:|......:..:::..:|:..||.|..|..||.|||..||
Zfish    38 CSARGPASYIVVFTGHWSPQTFPKQYPLFRPPAQWSKLMVVTHNEQYRLWQEGAPASDGMKSFAE 102

  Fly   242 HGATRTLENEIRENTQNGEVRTIIKAPGIPYRPKTFGTTLANARLDPVHHQISLAAKIDPSPDWI 306
            .|.|..|..:.:|..:...|.::.:..||   |...|.:.....|.|....:||..|:.|||||.
Zfish   103 QGLTVDLVKDAKEARKRRSVGSMYRTAGI---PSGIGHSSTEVLLTPRSPLVSLIVKLIPSPDWF 164

  Fly   307 LGVAGLELCLSNCTWLERKVLNLYPWDIGTDSGPSYMSSDEPQVPPDVVRRITSSYPSDHRSPFY 371
            :||.||.|| ....|.:....:|:|:|.|||||.::.|.:.|..||:.:..|||..|:...:.||
Zfish   165 VGVDGLNLC-EGGKWKQEVTFDLHPFDAGTDSGFTFSSPNFPTTPPENITMITSQKPNHPANSFY 228

  Fly   372 DDTGAPMKPLATLYLTRK-KLYIRECEEVP-------------QEGPLECAVHPWNEWTNCSTRC 422
            ......:.||||:::.|: :|.:|:...:.             .|.||:|.|..|:.|..|...|
Zfish   229 YPRLNELPPLATIWVKRQSRLPVRQQNRLSNHILPDASKPHRFSETPLDCEVSMWSSWGLCFGPC 293

  Fly   423 GQ-GYSHRQRSFKNPNLAANFNCDRRLEEFRQCQGTQC 459
            .: |..||.|........:...|. .|||..:|....|
Zfish   294 ARGGLRHRTRYILLKPANSGSPCP-ELEEQEECTPHNC 330

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30203NP_725128.2 Reeler 18..160 CDD:260081
Spond_N 183..372 CDD:283999 63/189 (33%)
TSP1 411..459 CDD:214559 13/49 (27%)
TSP1 492..541 CDD:214559
KU <739..773 CDD:197529
spon2aNP_571082.1 Spond_N 44..230 CDD:283999 63/190 (33%)
TSP1 283..330 CDD:214559 13/48 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3539
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D240419at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.