DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30203 and Spon1

Sequence 1:NP_725128.2 Gene:CG30203 FlyBaseID:FBgn0050203 Length:924 Species:Drosophila melanogaster
Sequence 2:NP_663559.1 Gene:Spon1 MGIID:2385287 Length:807 Species:Mus musculus

Alignment Length:643 Identity:195/644 (30%)
Similarity:302/644 (47%) Gaps:109/644 (17%)


  Fly    17 GVCNRIPQGASGPRSPVDDNFKILIDGNPETYVPEHQYNVSLSCPINMKFVSFTLVVEAEDPSAA 81
            |.|:||.: |.|.|......|.:.::|:|:.|.|...|.|:||......|..|||:...|:....
Mouse    42 GYCSRILR-AQGTRREGYTEFSLRVEGDPDFYKPGSSYRVTLSAAPPSYFRGFTLIALKENQEGD 105

  Fly    82 FGGQDMTGHFELLGVGDTRFSTSCENMVENTNTNAKIYIAVSWIAPRNPDSGCVLIKAGVVQHRD 146
             ..:|..|.|:::...:|:|.::|...|..:....:..|.|.||||.. .:|||::||.:||.|.
Mouse   106 -KEEDHAGTFQIIDEEETQFMSNCPVAVTESTPRRRTRIQVFWIAPPT-GTGCVILKASIVQKRI 168

  Fly   147 VWFLDDGFLTKRICPEEIDELNSLTP-PLETCCACDEAKYEIVLERKWARNTHWKDFP--SEDWR 208
            ::|.|:|.|||::| |:...|:.:|. |:..||||..|||.:.....|:..||.||:|  :..| 
Mouse   169 IYFQDEGSLTKKLC-EQDPTLDGVTDRPILDCCACGTAKYRLTFYGNWSEKTHPKDYPRRANHW- 231

  Fly   209 TRLGEVIGASHSHSYRYWAYGGRASKGMKELAEHGATRTLENEIRENTQNGEVRTIIKA----PG 269
               ..:||.|||.:|..|.|||.||:|:|::||.|:...:|.|||:  |:.||.|:|||    |.
Mouse   232 ---SAIIGGSHSKNYVLWEYGGYASEGVKQVAELGSPVKMEEEIRQ--QSDEVLTVIKAKAQWPA 291

  Fly   270 IPYRP-KTFGTTLANARLDPVHHQISLAAKIDPSPDWILGVAGLELCLSNCTWLERKVLNLYPWD 333
              ::| .......|...:|...|.:|....:.|||||.:|::..:||...|.|:::.|.:|.|||
Mouse   292 --WQPVNVRAAPSAEFSVDRTRHLMSFLTMMGPSPDWNVGLSAEDLCTKECGWVQKVVQDLIPWD 354

  Fly   334 IGTDSGPSYMSSDEPQVPPDVVRRITSSYPSDH-RSPFYDDTGAPMKPLATLYLTRKKLYIRECE 397
            .|||||.:|.|.::|.:|.:.:|.:||   .|| :|||||..|..:..:|.:.:.|......:|.
Mouse   355 AGTDSGVTYESPNKPTIPQEKIRPLTS---LDHPQSPFYDPEGGSITQVARVVIERIARKGEQCN 416

  Fly   398 EVP-----------------QEGPLECAVHPWNEWTNC-STRCGQGYSHRQRSFKNPNLAANFNC 444
            .||                 .:.|..|....|:.|:.| |:.|.:|...|||..| ..|..:..|
Mouse   417 IVPDNVDDIVADLAPEEKDEDDTPETCIYSNWSPWSACSSSTCEKGKRMRQRMLK-AQLDLSVPC 480

  Fly   445 DRRLEEFRQCQGTQCGAAEEELEGEEPGLGMENPPSSGSMAECQLTNWGEWSPCTKTCGRGSSTR 509
            . ..::|:.|.|..|        .:|.|            :.|.::.|..||||:.:||.|  .|
Mouse   481 P-DTQDFQPCMGPGC--------SDEDG------------STCTMSEWITWSPCSVSCGMG--MR 522

  Fly   510 TRDYYNPQARQRCLSVMRIPLEETREC-IGSDCGGT---IPDNGELDGFPEPDVFGETDHGGYMG 570
            :|:.|..|..:.. ||..:|.|||.:| :..:|..:   :.:.||.|.               ..
Mouse   523 SRERYVKQFPEDG-SVCMLPTEETEKCTVNEECSPSSCLVTEWGEWDD---------------CS 571

  Fly   571 KTTSWNSKQEHSSL------GSGNQAWNRK-----------------PYNSWKDKSLS 605
            .|.....|:.|..:      ||..:|...:                 |::.|.|.|::
Mouse   572 ATCGMGMKKRHRMVKMSPADGSMCKAETSQAEKCMMPECHTIPCLLSPWSEWSDCSVT 629

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30203NP_725128.2 Reeler 18..160 CDD:260081 47/142 (33%)
Spond_N 183..372 CDD:283999 77/197 (39%)
TSP1 411..459 CDD:214559 15/49 (31%)
TSP1 492..541 CDD:214559 19/50 (38%)
KU <739..773 CDD:197529
Spon1NP_663559.1 Reeler 43..182 CDD:260081 47/142 (33%)
Spond_N 205..392 CDD:283999 78/198 (39%)
TSP_1 446..494 CDD:278517 15/50 (30%)
TSP_1 505..554 CDD:278517 19/52 (37%)
TSP_1 562..610 CDD:278517 9/63 (14%)
TSP_1 618..665 CDD:278517 4/13 (31%)
TSP_1 672..720 CDD:278517
TSP_1 758..807 CDD:278517
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3539
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 396 1.000 Inparanoid score I1944
Isobase 1 0.950 0 Normalized mean entropy S5564
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D240419at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_132084
Panther 1 1.100 O PTHR11311
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.780

Return to query results.
Submit another query.