DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30203 and C11H1.5

Sequence 1:NP_725128.2 Gene:CG30203 FlyBaseID:FBgn0050203 Length:924 Species:Drosophila melanogaster
Sequence 2:NP_510387.2 Gene:C11H1.5 WormBaseID:WBGene00007530 Length:528 Species:Caenorhabditis elegans

Alignment Length:345 Identity:70/346 (20%)
Similarity:103/346 (30%) Gaps:132/346 (38%)


  Fly   483 SMAECQLTNWGEWSPCTKTCGRGSSTRTRDYYNPQARQ-----RCLSVMRIPLEETRECIGSDCG 542
            |.:||.::.||.||.|...|.:|...|.||...|..::     |.:..:...|.||:.|..:.||
 Worm    18 SQSECIVSEWGTWSKCHGGCQKGLIVRNRDVLQPPLQELTSEGRMMQRLCPHLYETKYCDQTTCG 82

  Fly   543 -------GTIPDNGELDGFPEPD-------------VFGETDHGGYMGKTTSWNSK--------Q 579
                   |..|:..::. |.|.:             |..:....|: ||.|...::        .
 Worm    83 MENTVNYGQFPETKKVK-FMEENRKLALETVSTKNLVERQMQKIGF-GKNTDDQTQAAIKKKFIS 145

  Fly   580 EHSSLGSGNQAWNRKPYNSWKDKSLSNPRDNAQESPNLPF-----DQIENPQ------------- 626
            |...|...:.|.||: |.       ..|.||...: |:|.     .|:.|.|             
 Worm   146 ETEQLFKLDDAINRR-YG-------PQPSDNLVNT-NIPLIDISTQQMTNKQWRDDRIASATKWT 201

  Fly   627 -----RPAYNPSDNMGGYDKGFP---------------------------PTNSYSNDKLVGNRP 659
                 .|:|.......|...|.|                           |:|.:|...|:....
 Worm   202 SIPTSTPSYREHLQAFGRAGGVPLLHITSTTSEPFSYHTRLHALNSRKIRPSNDHSVSILLRRIE 266

  Fly   660 GYNDFNSDYNNK-----------------DAY--------NDYTTPSFTSRTPFGSRYPNQQE-- 697
            ...|.|...:.|                 |||        :.|.:||.|:.|......|:..|  
 Worm   267 QALDTNQPLDEKYIKSALRTNRKLSKILVDAYRQRQSLMNSGYLSPSNTAPTVIKPYPPSSTESS 331

  Fly   698 -----------TVEGNTNDI 706
                       |....|:||
 Worm   332 IDFTTATESTSTPTSTTSDI 351

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30203NP_725128.2 Reeler 18..160 CDD:260081
Spond_N 183..372 CDD:283999
TSP1 411..459 CDD:214559
TSP1 492..541 CDD:214559 16/54 (30%)
KU <739..773 CDD:197529
C11H1.5NP_510387.2 TSP1 24..81 CDD:214559 16/57 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11311
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.