DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30203 and spon-1

Sequence 1:NP_725128.2 Gene:CG30203 FlyBaseID:FBgn0050203 Length:924 Species:Drosophila melanogaster
Sequence 2:NP_495473.2 Gene:spon-1 WormBaseID:WBGene00006893 Length:819 Species:Caenorhabditis elegans

Alignment Length:843 Identity:232/844 (27%)
Similarity:352/844 (42%) Gaps:197/844 (23%)


  Fly     1 MLRHIVLLILLSS----EVRGVCNRIPQGASGPRSPVDDNFKILIDGN-------PETYVPEHQY 54
            :|:.|:||:|:.|    |.:  |...|..|.|.:||..:.:.|.|:|.       .:.:||...|
 Worm     7 ILQFILLLLLIFSCNADEAK--CTIKPYEAKGDKSPGSNGYVIEINGTTTKSMDISKGFVPGEIY 69

  Fly    55 NVSL---SCPINMK-FVSFTLVVEAEDPSAAFGGQDMTGHFELLGVGDTRFSTSC-ENMVENTNT 114
            .||:   .....:| |..|.:....||.::|...|.:.||      ||.|.|..| ::.|.:.|.
 Worm    70 KVSIRGWRTQYTVKTFRGFVVSSLFEDNTSAGSWQVVKGH------GDARISPGCRQSGVSHANL 128

  Fly   115 NAKIYIAVSWIAPRNPDSGCVLIKAGVVQHRDVWFLDDGFLTKRICPEEIDE-LNSLTPPLETCC 178
            .:|..:.:.|.|| ...||||:.:|.|::.:.:||.:...||.::|.::..: |..:..|..|||
 Worm   129 KSKTSVHMMWKAP-EVSSGCVVFRASVIETKYIWFTEAEGLTVKLCIQKGTQILKPVDDPSATCC 192

  Fly   179 ACDEAKYEIVLERKWARNTHWKDFPSEDWRTRLGEVIGASHSHSYRYWAYGGRASKGMKELAEHG 243
            |||.|:|::.....|::|||.||:|:.:..|...:::|:|||.:|..|..||.::.||||:||.|
 Worm   193 ACDIAQYDLEFTGIWSKNTHPKDYPTLEHLTHFTDMLGSSHSSNYSLWTIGGISTDGMKEIAEWG 257

  Fly   244 ATRTLENEIRENTQNGEVRTIIKAPGIPYRPKTFGTTLANARLDPVHHQISLAAKIDPSPDWILG 308
            .|...|.|.:  .:..|||:::|..|: :.|...|||.:...::..||.:|||....|||||.:|
 Worm   258 NTYKAEAEAK--AKASEVRSLMKVKGL-WFPDVQGTTKSQFVVNKYHHFVSLATMFGPSPDWCVG 319

  Fly   309 VAGLELCLSNCTWLERKVLNLYPWDIGTDSGPSYMSSDEPQVPPDVVRRITSSYPSDHRSPFYDD 373
            ::.:.|||.:|||.|.:...|.|:|.||||||:|||.:||..|.:.:..||:..  :..||||:.
 Worm   320 LSSVNLCLPDCTWAEERTFELQPFDAGTDSGPTYMSPNEPTEPREPIHWITTKL--NPLSPFYNS 382

  Fly   374 TGAPMKPLATLYLTRKKLYIREC-----------------EEVPQEGPLECAVHPWNEWTNCSTR 421
            ....:..||.:.|.||.:...||                 |:...:...||.:..|..|:.||..
 Worm   383 KSDTIPTLAKVILRRKNVTSSECKSDDILKAEAHNITNTSEDEEYKDRRECMMTQWEPWSLCSAT 447

  Fly   422 CGQGYSHRQRSFKNPNLAANFNCDRRLEEFRQCQG--TQCGAAEEELEGEEPGLGMENPPSSGSM 484
            ||:|...|.|.:..|..|..|:|.|:..|.:.|..  .:|                ||  |....
 Worm   448 CGKGIRIRSRVYVFPIKAQVFHCHRQTTEKQFCNAKINEC----------------EN--SEAFS 494

  Fly   485 AECQLTNWGEWSPCTKTCGRGSSTRTRDYYNPQARQRCLSVMRIPLEETRECI---GSDCGGTIP 546
            ::||:::||.|..|:..||.|..:|.|.:.||..:....||   .||....|:   |.||..|  
 Worm   495 SKCQVSSWGSWGECSVQCGHGMRSRNRTFLNPATKSGDCSV---DLERKDICVGENGDDCNVT-- 554

  Fly   547 DNGELDGFPEPDVFGETDHGGYMGKTTSWNSKQEHS-SLGSGNQAWNRKPYNSWKDKSLSNPRDN 610
                    |:|           :.|||:|:.....| |...|.:...|..:.|..:|...:.  |
 Worm   555 --------PDP-----------LCKTTAWSDWSPCSASCDEGVRVRTRLFFYSEHEKRCMHV--N 598

  Fly   611 AQESPNLPFDQIENPQRPAYNPSDNMGGYDKGFPPTNS---YSNDKLVGNRPGYNDFNSDYNNKD 672
            .||.........                  :.|...||   ...||..|...|            
 Worm   599 LQEKDTCVMQSC------------------RRFIEINSEEICQEDKQAGQCAG------------ 633

  Fly   673 AYNDYTTPSFTSRTPFGSRYPNQQETVEGNTNDINGNYNVVQDYCFEKPYASTLPCFAKPVVESN 737
                              .:|                                           .
 Worm   634 ------------------NFP-------------------------------------------R 637

  Fly   738 YWFYDHEDHECKIFTTDNCDQNRNRFRTLTACEGTCLQPQINMERS---ENDAMDLYGRRSYD 797
            || |:||..:|:.|....|..|||:|.|...|:..|| |.....:|   .|..::.:|....|
 Worm   638 YW-YNHEKTQCERFIFTGCKGNRNQFETEEECKQICL-PGYEKSKSLIPNNQLLEDFGNTEVD 698

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30203NP_725128.2 Reeler 18..160 CDD:260081 44/154 (29%)
Spond_N 183..372 CDD:283999 76/189 (40%)
TSP1 411..459 CDD:214559 16/50 (32%)
TSP1 492..541 CDD:214559 18/52 (35%)
KU <739..773 CDD:197529 13/34 (38%)
spon-1NP_495473.2 Reeler 36..171 CDD:260081 41/142 (29%)
Spond_N 197..381 CDD:283999 76/189 (40%)
TSP1 435..481 CDD:214559 16/46 (35%)
TSP1 499..551 CDD:214559 18/55 (33%)
TSP1 562..610 CDD:214559 11/50 (22%)
Kunitz_BPTI 621..672 CDD:278443 19/125 (15%)
TSP1 708..759 CDD:214559
TSP1 766..816 CDD:214559
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3539
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S5564
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D240419at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_132084
Panther 1 1.100 O PTHR11311
Phylome 1 0.910 0.724 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.730

Return to query results.
Submit another query.