DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30203 and SPON2

Sequence 1:NP_725128.2 Gene:CG30203 FlyBaseID:FBgn0050203 Length:924 Species:Drosophila melanogaster
Sequence 2:NP_001121797.1 Gene:SPON2 HGNCID:11253 Length:331 Species:Homo sapiens

Alignment Length:328 Identity:102/329 (31%)
Similarity:143/329 (43%) Gaps:30/329 (9%)


  Fly   155 LTKRICPEEIDELNSLTPPL---ETCCACDEAKYEIVLERKWARNTHWKDFPSEDWRTRLGEVIG 216
            |.|.:|...:..|.:...||   ..|.|...|||.|....||::....|.:|......:...::|
Human    10 LGKALCALLLATLGAAGQPLGGESICSARAPAKYSITFTGKWSQTAFPKQYPLFRPPAQWSSLLG 74

  Fly   217 ASHSHSYRYWAYGGRASKGMKELAEHGATRTLENEIR---ENTQNGEVRTIIKAPGIPYRPKTFG 278
            |:||..|..|......|.|:::.||.|....|..||.   |..|:  |..:..||.:   |...|
Human    75 AAHSSDYSMWRKNQYVSNGLRDFAERGEAWALMKEIEAAGEALQS--VHAVFSAPAV---PSGTG 134

  Fly   279 TTLANARLDPVHHQISLAAKIDPSPDWILGVAGLELCLSNCTWLERKVLNLYPWDIGTDSGPSYM 343
            .|.|...:...|..:|...:|.|||||.:||..|:|| ....|.|:..|:|||:|.|||||.::.
Human   135 QTSAELEVQRRHSLVSFVVRIVPSPDWFVGVDSLDLC-DGDRWREQAALDLYPYDAGTDSGFTFS 198

  Fly   344 SSDEPQVPPDVVRRITSSYPSDHRSPFYDDTGAPMKPLATLYLTR----KKLYIRECEEVPQ--- 401
            |.:...:|.|.|..||||.||...:.||......:.|:|.:.|.|    .:.:|.....:|.   
Human   199 SPNFATIPQDTVTEITSSSPSHPANSFYYPRLKALPPIARVTLVRLRQSPRAFIPPAPVLPSRDN 263

  Fly   402 ---------EGPLECAVHPWNEWTNCSTRCGQ-GYSHRQRSFKNPNLAANFNCDRRLEEFRQCQG 456
                     |.||:|.|..|:.|..|...||: |...|.| :.....|.|.:....|||..:|..
Human   264 EIVDSASVPETPLDCEVSLWSSWGLCGGHCGRLGTKSRTR-YVRVQPANNGSPCPELEEEAECVP 327

  Fly   457 TQC 459
            ..|
Human   328 DNC 330

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30203NP_725128.2 Reeler 18..160 CDD:260081 2/5 (40%)
Spond_N 183..372 CDD:283999 68/192 (35%)
TSP1 411..459 CDD:214559 14/49 (29%)
TSP1 492..541 CDD:214559
KU <739..773 CDD:197529
SPON2NP_001121797.1 Spond_N 41..228 CDD:283999 68/193 (35%)
TSP1 280..330 CDD:214559 15/51 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3539
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D240419at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.