DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30203 and LOC100910790

Sequence 1:NP_725128.2 Gene:CG30203 FlyBaseID:FBgn0050203 Length:924 Species:Drosophila melanogaster
Sequence 2:XP_008768632.1 Gene:LOC100910790 RGDID:6496621 Length:358 Species:Rattus norvegicus

Alignment Length:251 Identity:80/252 (32%)
Similarity:114/252 (45%) Gaps:27/252 (11%)


  Fly   177 CCACDEAKYEIVLERKWARNTHWKDFPSEDWRTRLGEVIGASHSHSYRYWAYGGRASKGMKELAE 241
            |.|...|:|.|....||::....|.:|......:...::||:||..|..|......|.|:::.||
  Rat    34 CTARPLARYSITFTGKWSQTAFPKQYPLFRPPAQWSSLLGAAHSSDYSMWRKNEYVSNGLRDFAE 98

  Fly   242 HGATRTLENEIR---ENTQNGEVRTIIKAPGIPYRPKTFGTTLANARLDPVHHQISLAAKIDPSP 303
            .|....|..||.   |..|:  |..:..||.:   |...|.|.|...:.|.|..:|...:|.|||
  Rat    99 RGEAWALMKEIEAAGEKLQS--VHAVFSAPAV---PSGTGQTSAELEVHPRHSLVSFVVRIVPSP 158

  Fly   304 DWILGVAGLELCLSNCTWLERKVLNLYPWDIGTDSGPSYMSSDEPQVPPDVVRRITSSYPSDHRS 368
            ||.:|:..|:|| ....|.|:.||:|||.|.|||||.::.|.:...:|.|.|..||:|.||...:
  Rat   159 DWFVGIDSLDLC-EGGRWKEQVVLDLYPHDAGTDSGFTFSSPNFATIPQDTVTEITASSPSHPAN 222

  Fly   369 PFYDDTGAPMKPLA-----------------TLYLTRKKLYIRECEEVPQEGPLEC 407
            .||......:.|:|                 :|.|..:...|.:...|| |.||:|
  Rat   223 SFYYPRLKSLPPIAKVTFVRLRQSPRAFAPPSLDLASRGNEIVDSLSVP-ETPLDC 277

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30203NP_725128.2 Reeler 18..160 CDD:260081
Spond_N 183..372 CDD:283999 67/192 (35%)
TSP1 411..459 CDD:214559
TSP1 492..541 CDD:214559
KU <739..773 CDD:197529
LOC100910790XP_008768632.1 Spond_N 40..227 CDD:283999 67/193 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D240419at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.