| Sequence 1: | NP_725128.2 | Gene: | CG30203 / 246514 | FlyBaseID: | FBgn0050203 | Length: | 924 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_598664.3 | Gene: | Spon2 / 100689 | MGIID: | 1923724 | Length: | 330 | Species: | Mus musculus | 
| Alignment Length: | 325 | Identity: | 101/325 - (31%) | 
|---|---|---|---|
| Similarity: | 140/325 - (43%) | Gaps: | 48/325 - (14%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly   168 NSLTPPL---ETCCACDEAKYEIVLERKWARNTHWKDFPSEDWRTRLGEVIGASHSHSYRYWAYG 229 
  Fly   230 GRASKGMKELAEHGATRTLENEIR---ENTQNGEVRTIIKAPGIPYRPKTFGTTLANARLDPVHH 291 
  Fly   292 QISLAAKIDPSPDWILGVAGLELCLSNCTWLERKVLNLYPWDIGTDSGPSYMSSDEPQVPPDVVR 356 
  Fly   357 RITSSYPSDHRSPFYDDTGAPMKPLA-----------------TLYLTRKKLYIRECEEVPQEGP 404 
  Fly   405 LECAVHPWNEWTNCSTRCGQ-GYSHRQRSFK-NPNLAANFNCDRRLEEFRQCQGTQCGAAEEELE 467 
  Fly   468  467 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| CG30203 | NP_725128.2 | Reeler | 18..160 | CDD:260081 | |
| Spond_N | 183..372 | CDD:283999 | 66/191 (35%) | ||
| TSP1 | 411..459 | CDD:214559 | 13/49 (27%) | ||
| TSP1 | 492..541 | CDD:214559 | |||
| KU | <739..773 | CDD:197529 | |||
| Spon2 | NP_598664.3 | Spond_N | 40..227 | CDD:368927 | 67/192 (35%) | 
| TSP1 | 279..329 | CDD:214559 | 19/61 (31%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3539 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||