DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30203 and Spon2

Sequence 1:NP_725128.2 Gene:CG30203 FlyBaseID:FBgn0050203 Length:924 Species:Drosophila melanogaster
Sequence 2:NP_598664.3 Gene:Spon2 MGIID:1923724 Length:330 Species:Mus musculus

Alignment Length:325 Identity:101/326 (31%)
Similarity:140/326 (43%) Gaps:48/326 (15%)


  Fly   168 NSLTPPL---ETCCACDEAKYEIVLERKWARNTHWKDFPSEDWRTRLGEVIGASHSHSYRYWAYG 229
            ::.:.||   ..|.|...|:|.|....||::....|.:|......:...::||:||..|..|...
Mouse    22 STTSQPLGGESVCTARPLARYSITFIGKWSQTAFPKQYPLFRPPAQWSSLLGAAHSSDYSMWRKN 86

  Fly   230 GRASKGMKELAEHGATRTLENEIR---ENTQNGEVRTIIKAPGIPYRPKTFGTTLANARLDPVHH 291
            ...|.|:::.||.|....|..||.   |..|:  |..:..||.|   |...|.|.....:.|.|.
Mouse    87 EYVSNGLRDFAERGEAWALMKEIEAAGEKLQS--VHAVFSAPAI---PSGTGQTSTELEVHPRHS 146

  Fly   292 QISLAAKIDPSPDWILGVAGLELCLSNCTWLERKVLNLYPWDIGTDSGPSYMSSDEPQVPPDVVR 356
            .:|...:|.|||||.:|:..|:|| ....|.|:.||:|||.|.|||||.::.|.:...:|.|.|.
Mouse   147 LVSFVVRIVPSPDWFVGIDSLDLC-EGGRWKEQVVLDLYPHDAGTDSGFTFSSPNFATIPQDTVT 210

  Fly   357 RITSSYPSDHRSPFYDDTGAPMKPLA-----------------TLYLTRKKLYIRECEEVPQEGP 404
            .||:|.||...:.||......:.|:|                 :|.|..:...|.:...|| |.|
Mouse   211 EITASSPSHPANSFYYPRLKSLPPIAKVTFVRLQQSPRAFAPPSLDLASRGNEIVDSLSVP-ETP 274

  Fly   405 LECAVHPWNEWTNCSTRCGQ-GYSHRQRSFK-NPNLAANFNCDRRLEEFRQCQGTQCGAAEEELE 467
            |:|.|..|:.|..|...||: |...|.|..: .|   ||             .||.|...|||.|
Mouse   275 LDCEVSLWSSWGLCGGPCGKLGAKSRTRYVRVQP---AN-------------NGTPCPELEEEAE 323

  Fly   468  467
            Mouse   324  323

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30203NP_725128.2 Reeler 18..160 CDD:260081
Spond_N 183..372 CDD:283999 67/192 (35%)
TSP1 411..459 CDD:214559 13/50 (26%)
TSP1 492..541 CDD:214559
KU <739..773 CDD:197529
Spon2NP_598664.3 Spond_N 40..227 CDD:283999 67/193 (35%)
TSP1 279..329 CDD:214559 19/62 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3539
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.