DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30203 and spon1

Sequence 1:NP_725128.2 Gene:CG30203 FlyBaseID:FBgn0050203 Length:924 Species:Drosophila melanogaster
Sequence 2:NP_001090741.1 Gene:spon1 XenbaseID:XB-GENE-991006 Length:803 Species:Xenopus tropicalis

Alignment Length:682 Identity:201/683 (29%)
Similarity:302/683 (44%) Gaps:119/683 (17%)


  Fly    11 LSSEVRGVCNRIPQGASGPRSPVDDNFKILIDGNPETYVPEHQYNVSLSCPINMKFVSFTLVVEA 75
            :.||  |.|:||.:.....|....:.|.:.::|:||.|.|.:.|.|:|.......|..|||:...
 Frog    33 IKSE--GYCSRILRAQGSTRKEGYNEFSLRVEGDPEFYKPGNTYRVTLLAASPAYFRGFTLIALK 95

  Fly    76 EDPSAAFGGQDMTGHFELLGVGDTRFSTSCENMVENTNTNAKIYIAVSWIAPRNP-DSGCVLIKA 139
            |..... ..:|..|.|:::...||:|.::|...|..:....:..|.|.|.||  | .||||::||
 Frog    96 EGKEGE-KEEDHAGTFQIIDDEDTQFMSNCPVAVTESTPRRRTRIQVLWTAP--PIGSGCVILKA 157

  Fly   140 GVVQHRDVWFLDDGFLTKRICPEEIDELNSLTPPLETCCACDEAKYEIVLERKWARNTHWKDFP- 203
            .:||.:.::|.|:|.||||:|..::........|:..||||..|||.:.....|:..||.||:| 
 Frog   158 SIVQKKIIYFQDEGSLTKRMCEPDLTLEGGNEKPIPDCCACGTAKYRLTFYGNWSEKTHPKDYPR 222

  Fly   204 -SEDWRTRLGEVIGASHSHSYRYWAYGGRASKGMKELAEHGATRTLENEIRENTQNGEVRTIIKA 267
             :..|    ..:||.|||..|..|.|||:||.|:|::||.|:...:|.|||:  :..||.|:|||
 Frog   223 RANHW----SAIIGGSHSKEYVLWEYGGQASDGVKQVAELGSPVKMEEEIRQ--KGDEVLTVIKA 281

  Fly   268 ----PGIPYRP-KTFGTTLANARLDPVHHQISLAAKIDPSPDWILGVAGLELCLSNCTWLERKVL 327
                |.  ::| .......|...:|...|.:|..|.:.|||||.:|::..:||...|.|:::.:.
 Frog   282 KAQWPA--WQPLNVRAAPSAEFSVDRSRHLMSFLAMMGPSPDWNVGLSSEDLCTKECGWVQKVIQ 344

  Fly   328 NLYPWDIGTDSGPSYMSSDEPQVPPDVVRRITSSYPSDH-RSPFYDDTGAPMKPLATLYLTRKKL 391
            :|.|||.|||||.:|.|.::|.:|.|.:|.:||   .|| :|||||..|.|:.|:|.:.:.|...
 Frog   345 DLIPWDAGTDSGVTYESPNKPSIPQDKIRPLTS---LDHPQSPFYDPEGGPIIPVARVVIERIAR 406

  Fly   392 YIRECEEVP-----------------QEGPLECAVHPWNEWTNCST-RCGQGYSHRQRSFKNPNL 438
            ...:|..||                 .:.|..|....|:.|:.||: .|.:|...|||..| ..|
 Frog   407 KGDQCNIVPDNVDDIVPDLVTEEKEEDDTPETCIYSNWSPWSACSSATCDKGKRMRQRMLK-AQL 470

  Fly   439 AANFNCDRRLEEFRQCQGTQCGAAEEELEGEEPGLGMENPPSSGSMAECQLTNWGEWSPCTKTCG 503
            ..:..|. ..::|..|.|..|                    |....:.|.::.|..||||:.:||
 Frog   471 DLSVPCP-DTQDFEPCMGPGC--------------------SDDEASTCMMSEWITWSPCSASCG 514

  Fly   504 RGSSTRTRDYYN--PQARQRCLSVMRIPLEETRECI-GSDCGGTIPDNGELDGFPEPDVFGETDH 565
            .|..:|.| |..  |:....|    ::|.|||.:|| ..:|.            |...:..|...
 Frog   515 MGMRSRER-YVKQFPEDGSMC----KVPTEETEKCIVNEECE------------PSSCIVTEWAE 562

  Fly   566 GGYMGKTTSWNSKQEHSSL------GSGNQAWNRK-----------------PYNSWKDKSL--- 604
            ......|.....|:.|..:      ||..:|...:                 |::.|.|.|:   
 Frog   563 WEECSATCGMGMKKRHRMIKMTPADGSMCKADTTEVEKCMMPECHTIPCVLSPWSEWSDCSVTCG 627

  Fly   605 --SNPRDNAQESP------NLPFDQIENPQRP 628
              :..|....:||      |....|:|....|
 Frog   628 KGTRTRQRMLKSPAELGDCNEELKQVEKCMLP 659

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30203NP_725128.2 Reeler 18..160 CDD:260081 47/143 (33%)
Spond_N 183..372 CDD:283999 77/197 (39%)
TSP1 411..459 CDD:214559 15/49 (31%)
TSP1 492..541 CDD:214559 19/52 (37%)
KU <739..773 CDD:197529
spon1NP_001090741.1 Reeler 38..178 CDD:260081 47/143 (33%)
Spond_N 201..388 CDD:310815 78/198 (39%)
TSP_1 442..490 CDD:306574 15/50 (30%)
TSP_1 501..550 CDD:306574 19/54 (35%)
TSP_1 558..606 CDD:306574 7/48 (15%)
TSP_1 614..661 CDD:306574 11/47 (23%)
TSP_1 668..716 CDD:306574
TSP_1 755..803 CDD:306574
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3539
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D240419at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
43.780

Return to query results.
Submit another query.