DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18853 and PHR1

Sequence 1:NP_724615.1 Gene:CG18853 FlyBaseID:FBgn0042173 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_849651.1 Gene:PHR1 AraportID:AT1G12370 Length:496 Species:Arabidopsis thaliana

Alignment Length:416 Identity:150/417 (36%)
Similarity:205/417 (49%) Gaps:100/417 (24%)


  Fly     5 DLKS-QLTIARNEINNLRQQVRNLQ----HVQRKDIETI---------TRLLQDF-------RC- 47
            |.|: ||......:..|..|:.:||    .:|....|||         :.|:.||       || 
plant    72 DAKARQLGFMLKGLRQLHHQIDSLQIPFFLLQGDAKETIPNFLTECGASHLVTDFSPLREIRRCK 136

  Fly    48 --------EGCANNNKSAKDKV----AGEKQEHQHQQQTQDQQTGQGQSNYTNGGHCLGEDYAHF 100
                    :..|.:...|.:.|    |..|.|:       ..:|.:|:.|.....:.:  ::...
plant   137 DEVVKRTSDSLAIHEVDAHNVVPMWAASSKLEY-------SARTIRGKINKLLPDYLI--EFPKL 192

  Fly   101 RPIGVIRTAFPEKRAVPRQSIVGSRLR-----------------GIIQL---NDGVFT------- 138
            .|.....|...:|:.|...|::...:|                 ||..|   .||..|       
plant   193 EPPKKKWTGMMDKKLVDWDSLIDKVVREGAEVPEIEWCVPGEDAGIEVLMGNKDGFLTKRLKNYS 257

  Fly   139 ----NP--EHSLEGLEDFSHLWLIYHFHR--------NNSHPKA-------------KADNFCFY 176
                ||  ..:|.||..:.|...: ...|        .::.|:|             .:||||:|
plant   258 TDRNNPIKPKALSGLSPYLHFGQV-SAQRCALEARKVRSTSPQAVDTFLEELIVRRELSDNFCYY 321

  Fly   177 NEHYDSLKGLSSWAYQTLDAHRKDKRDPCYSLEELEKSLTYDDLWNSAQLQLVREGKMHGFLRMY 241
            ..|||||||...||.::|..|..|||:..||||:|||.||.|.|||::||::|.:||||||:|||
plant   322 QPHYDSLKGAWEWARKSLMDHASDKREHIYSLEQLEKGLTADPLWNASQLEMVYQGKMHGFMRMY 386

  Fly   242 WAKKILEWTATPEHALEYAILLNDKYSLDGRDPNGYVGCMWSIGGVHDMGWKERAIFGKVRYMNY 306
            |||||||||..||.||..:|.||:||.:|||||:|||||||||.||||.|||||.:|||:|||||
plant   387 WAKKILEWTKGPEEALSISIYLNNKYEIDGRDPSGYVGCMWSICGVHDQGWKERPVFGKIRYMNY 451

  Fly   307 QGCRRKFDVNAFV--MRYGGKVHKKK 330
            .||:|||:|::::  ::....|.|||
plant   452 AGCKRKFNVDSYISYVKSLVSVTKKK 477

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18853NP_724615.1 UPF0066 100..>163 CDD:294485 19/104 (18%)
PHR1NP_849651.1 phr2 5..467 CDD:129679 146/405 (36%)
DNA_photolyase 30..193 CDD:279247 26/130 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10211
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.