DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18853 and cry

Sequence 1:NP_724615.1 Gene:CG18853 FlyBaseID:FBgn0042173 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_732407.1 Gene:cry FlyBaseID:FBgn0025680 Length:542 Species:Drosophila melanogaster

Alignment Length:145 Identity:36/146 (25%)
Similarity:54/146 (37%) Gaps:49/146 (34%)


  Fly   175 FY-----NEHYDSLKGLSSWAYQTLDAHRKDKRDPCYSL------EELEKS----LTYDDLWNSA 224
            ||     |.:||.::|                .|.|.|:      |.|.:|    .|...|.:.|
  Fly   318 FYTMSVNNPNYDRMEG----------------NDICLSIPWAKPNENLLQSWRLGQTGFPLIDGA 366

  Fly   225 QLQLVREGKMHGFLRMYWAKKILE---WTATPEHALEYAILLNDKYSLDGRDPNGYVGCMWSIGG 286
            ..||:.||.:|..||...|..:..   |.:. ||.|::.:    ||.||..         ||:..
  Fly   367 MRQLLAEGWLHHTLRNTVATFLTRGGLWQSW-EHGLQHFL----KYLLDAD---------WSVCA 417

  Fly   287 VHDMGWKERAIFGKV 301
            .:.| |...:.|.::
  Fly   418 GNWM-WVSSSAFERL 431

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18853NP_724615.1 UPF0066 100..>163 CDD:294485
cryNP_732407.1 PhrB 4..504 CDD:223492 36/146 (25%)
DNA_photolyase 8..175 CDD:279247
FAD_binding_7 310..510 CDD:281440 36/146 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0415
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.