DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18853 and cry2

Sequence 1:NP_724615.1 Gene:CG18853 FlyBaseID:FBgn0042173 Length:330 Species:Drosophila melanogaster
Sequence 2:XP_002934138.2 Gene:cry2 XenbaseID:XB-GENE-984563 Length:662 Species:Xenopus tropicalis

Alignment Length:97 Identity:24/98 (24%)
Similarity:37/98 (38%) Gaps:18/98 (18%)


  Fly   140 PEHSLEGLEDFSHLWLIYHFHRNNSHPK---AKADNFCFYNEHYDSLKGLSSWA-----YQTLDA 196
            |..||.|    ..||..:.:....::||   .:.:..|.......:.|.|:.||     :..:||
 Frog   378 PPLSLYG----QLLWREFFYTAATNNPKFDQMEGNPICVQIPWDKNPKALAKWAEGKTGFPWIDA 438

  Fly   197 HRKDKRDPCYSLEELEKS-----LTYDDLWNS 223
            .....|...: :..|.:.     ||..|||||
 Frog   439 IMTQLRQEGW-IHHLARHAVACFLTRGDLWNS 469

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18853NP_724615.1 UPF0066 100..>163 CDD:294485 6/23 (26%)
cry2XP_002934138.2 photolyase_8HDF 138..587 CDD:274644 24/98 (24%)
DNA_photolyase <149..265 CDD:279247
FAD_binding_7 309..582 CDD:281440 24/98 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0415
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.