| Sequence 1: | NP_660194.1 | Gene: | AIMP3 / 246507 | FlyBaseID: | FBgn0050185 | Length: | 179 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_012842.1 | Gene: | TEF4 / 853781 | SGDID: | S000001564 | Length: | 412 | Species: | Saccharomyces cerevisiae |
| Alignment Length: | 203 | Identity: | 40/203 - (19%) |
|---|---|---|---|
| Similarity: | 62/203 - (30%) | Gaps: | 74/203 - (36%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 5 ATVQKIANCLGVNPGKVQLNEEQVVTRTSGQKKSVAGFASILESLASESK--SETAQNSRASREV 67
Fly 68 EA-----------------------------QVYQWIEFSVLYVAPGSKDK----YVSKQLLAD- 98
Fly 99 FNKLFASKSYLVG----------------------HFITLADLAVYYAIYDLVKSLSPV---DKE 138
Fly 139 VYLNLSRW 146 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| AIMP3 | NP_660194.1 | GST_C_AIMP3 | 65..166 | CDD:198338 | 28/141 (20%) |
| TEF4 | NP_012842.1 | GST_N_EF1Bgamma | 4..72 | CDD:239342 | |
| GST_C_EF1Bgamma_like | 89..211 | CDD:198290 | 2/7 (29%) | ||
| EF1G | 253..356 | CDD:395522 | 16/102 (16%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG0625 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||