DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AIMP3 and GstE3

Sequence 1:NP_660194.1 Gene:AIMP3 FlyBaseID:FBgn0050185 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_611325.2 Gene:GstE3 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster

Alignment Length:52 Identity:15/53 (28%)
Similarity:23/53 (43%) Gaps:1/53 (2%)


  Fly   100 NKLFASKSYLVGHFITLADLAVYYAIYDLVKSLSPVDKEVYLNLSRWFDHLQ 151
            |....:.:||.|..:|:||..|...:......| |||...|..|:.|...::
  Fly   142 NLFLENGNYLAGDNLTIADFHVIAGLTGFFVFL-PVDATKYPELAAWIKRIK 192

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AIMP3NP_660194.1 GST_C_AIMP3 65..166 CDD:198338 15/53 (28%)
GstE3NP_611325.2 GstA 4..195 CDD:223698 15/53 (28%)
GST_N_Delta_Epsilon 4..77 CDD:239343
GST_C_Delta_Epsilon 91..208 CDD:198287 15/53 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.