DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AIMP3 and GstT4

Sequence 1:NP_660194.1 Gene:AIMP3 FlyBaseID:FBgn0050185 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_572886.2 Gene:GstT4 FlyBaseID:FBgn0030484 Length:237 Species:Drosophila melanogaster

Alignment Length:158 Identity:40/159 (25%)
Similarity:65/159 (41%) Gaps:21/159 (13%)


  Fly    22 QLNEEQVVTRTSGQKKSV---------AGFASILESLASESKSETAQNSRASREVEAQVYQWIEF 77
            ||:|...:.|...::|.|         .|.:.|.|.||.:      |.:......|....:|:..
  Fly    66 QLSENVAIFRHLAREKLVPEHWYPRRHLGRSRIDEYLAWQ------QTNMGVATTEYFQQKWLVP 124

  Fly    78 SVLYVAPGSKD-KYVSKQL---LADFNKLFA-SKSYLVGHFITLADLAVYYAIYDLVKSLSPVDK 137
            .:....|.... ...||||   |.:|.:||. |:.:::|..|:.|||:....| |..||:.....
  Fly   125 YLQKTRPADNAVNLASKQLEHTLNEFEQLFLNSRKFMMGDNISYADLSAICEI-DQPKSIGYNAF 188

  Fly   138 EVYLNLSRWFDHLQNRADVHQGEPLLNF 165
            :....|:||::.::.....|..|.|..|
  Fly   189 QNRNKLARWYETVREELGPHYKEVLGEF 216

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AIMP3NP_660194.1 GST_C_AIMP3 65..166 CDD:198338 28/107 (26%)
GstT4NP_572886.2 GstA 5..203 CDD:223698 36/144 (25%)
GST_N_Theta 5..80 CDD:239348 4/14 (29%)
GST_C_Theta 95..220 CDD:198292 33/130 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.