DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AIMP3 and eef1g

Sequence 1:NP_660194.1 Gene:AIMP3 FlyBaseID:FBgn0050185 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_775370.1 Gene:eef1g ZFINID:ZDB-GENE-020423-3 Length:442 Species:Danio rerio

Alignment Length:102 Identity:29/103 (28%)
Similarity:49/103 (48%) Gaps:20/103 (19%)


  Fly    66 EVEAQVYQWIEFSVLYVAPGS-------------------KDKYVSKQLLADFNKLFASKSYLVG 111
            :..|||.||:.|:...|.|.:                   :.|...|::||..|:...::::|||
Zfish    90 QASAQVLQWVSFADSEVIPPASAWVFPTLGIMQFNKQATEQAKEEVKRVLAVLNQHLNTRTFLVG 154

  Fly   112 HFITLADLAVYYAIYDLVKS-LSPVDKEVYLNLSRWF 147
            ..|:|||:.|..::..|.|. |....::.|.|::|||
Zfish   155 ERISLADITVVCSLLWLYKQVLELAFRQPYPNVTRWF 191

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AIMP3NP_660194.1 GST_C_AIMP3 65..166 CDD:198338 29/103 (28%)
eef1gNP_775370.1 GST_N_EF1Bgamma 4..82 CDD:239342
maiA 5..201 CDD:273527 29/103 (28%)
GST_C_EF1Bgamma_like 91..213 CDD:198290 29/102 (28%)
EF1G 280..386 CDD:279041
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.