DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HSPC300 and Brk1

DIOPT Version :8

Sequence 1:NP_001286810.1 Gene:HSPC300 / 246497 FlyBaseID:FBgn0061198 Length:76 Species:Drosophila melanogaster
Sequence 2:NP_598698.1 Gene:Brk1 / 101314 MGIID:1915406 Length:75 Species:Mus musculus

Alignment Length:76 Identity:56/76 - (73%)
Similarity:68/76 - (89%) Gaps:1/76 - (1%)


  Fly     1 MSGAHREAIQKQIHQDWANREYIEVITASIKRITDFLNSFDMSCRSRLAVLNEKLTILERRIDYL 65
            |:| ..:.:|::||||||||||||:||:|||:|:|||||||||||||||.||||||.|||||:|:
Mouse     1 MAG-QEDPVQREIHQDWANREYIEIITSSIKKISDFLNSFDMSCRSRLATLNEKLTALERRIEYI 64

  Fly    66 EACVAQGETLT 76
            ||.|.:|||||
Mouse    65 EARVTKGETLT 75

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HSPC300NP_001286810.1 DUF2360 34..>67 CDD:287161 27/32 (84%)
Brk1NP_598698.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C207464312
eggNOG 1 0.900 E1_2CHT7
Hieranoid 1 1.000
Homologene 1 1.000 H10210
Inparanoid 1 1.050 117 1.000 Inparanoid score I4762
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006533
OrthoInspector 1 1.000 T1083370
orthoMCL 1 0.900 OOG5_133194
Panther 1 1.100 LDO PTHR33668
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2987
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.