DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr60D and Lcp9

DIOPT Version :10

Sequence 1:NP_726468.1 Gene:Cpr60D / 246492 FlyBaseID:FBgn0050163 Length:93 Species:Drosophila melanogaster
Sequence 2:NP_523854.1 Gene:Lcp9 / 37963 FlyBaseID:FBgn0025578 Length:92 Species:Drosophila melanogaster


Alignment Length:97 Identity:31/97 - (31%)
Similarity:51/97 - (52%) Gaps:11/97 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKYSLIFALFVVLASCSEEDLQAQLLKSENRQNLDGAGQFQHEITVSNGIQVKAQGNVNG----- 61
            :|:.::.|..:.:...:||   |.::||::..||   ..|.:...:||.|:....|.:..     
  Fly     1 MKFVIVLACLLAVVFANEE---ADVVKSDSEVNL---LDFNYAYELSNHIRAVQTGALKEHDNWV 59

  Fly    62 IQGEYFLPGEDGKQIRVTYTADATGFHPKVEE 93
            :.|||.....:||.::|.||||.||:||||.|
  Fly    60 VSGEYEYVAPNGKTVKVVYTADETGYHPKVVE 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr60DNP_726468.1 Chitin_bind_4 41..87 CDD:459790 16/50 (32%)
Lcp9NP_523854.1 Chitin_bind_4 34..85 CDD:459790 16/50 (32%)

Return to query results.
Submit another query.