DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr60D and Lcp9

DIOPT Version :8

Sequence 1:NP_001286853.1 Gene:Cpr60D / 246492 FlyBaseID:FBgn0050163 Length:93 Species:Drosophila melanogaster
Sequence 2:NP_523854.1 Gene:Lcp9 / 37963 FlyBaseID:FBgn0025578 Length:92 Species:Drosophila melanogaster

Alignment Length:97 Identity:31/98 (32%)
Similarity:51/98 (52%) Gaps:11/98 (11%)


  Fly     2 LKYSLIFALFVVLASCSEEDLQAQLLKSENRQNLDGAGQFQHEITVSNGIQVKAQGNVNG----- 61
            :|:.::.|..:.:...:||   |.::||::..||   ..|.:...:||.|:....|.:..     
  Fly     1 MKFVIVLACLLAVVFANEE---ADVVKSDSEVNL---LDFNYAYELSNHIRAVQTGALKEHDNWV 59

  Fly    62 IQGEYFLPGEDGKQIRVTYTADATGFHPKVEE 93
            :.|||.....:||.::|.||||.||:||||.|
  Fly    60 VSGEYEYVAPNGKTVKVVYTADETGYHPKVVE 91

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr60DNP_001286853.1 Chitin_bind_4 41..87 CDD:278791 17/51 (33%)
Lcp9NP_523854.1 Chitin_bind_4 34..85 CDD:278791 17/51 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10380
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.