| Sequence 1: | NP_611218.1 | Gene: | NT5E-2 / 246458 | FlyBaseID: | FBgn0050104 | Length: | 585 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_012072.3 | Gene: | YHR202W / 856609 | SGDID: | S000001245 | Length: | 602 | Species: | Saccharomyces cerevisiae | 
| Alignment Length: | 632 | Identity: | 119/632 - (18%) | 
|---|---|---|---|
| Similarity: | 212/632 - (33%) | Gaps: | 198/632 - (31%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly    36 LHNNDMH----ARFDQTSVNSGTCPPEDVHTNKCYGGFARVAHEVR-KYRKEAQEGGTSVLYLNA 95 
  Fly    96 GDTYTG-----TSWFTIFKDKIASAFLNKLKPDAISLGNHEFDERVEGLIPFLNEVTFPVLACNL 155 
  Fly   156 DLSKVPQLKATWHLANSAILETNGTKV----GVIGYLTPDTKKLTLNMDVEFN------------ 204 
  Fly   205 --EEVESIN-----VEAKKLKAQGIKIIIALGHSGYLKDLE---------IAKNCPEVDI-VIGG 252 
  Fly   253 HT-----------NTFLYTGAQPD---------AEHIDGPYPTMVKQ--NSGKEVPVVQAYAYTK 295 
  Fly   296 YLGKL-HVQFDADGNLIQWDGSPILLNASVAQEQDLLDLLEVFRPNVTRLEKSVVGHTKVHLEGN 359 
  Fly   360 KAVCRAEECNLGNLIADAMV------------FSRLMEEQGGDFWTDAAISIMQGGGIRSSIEKR 412 
  Fly   413 SDGAITDNDILSVLPWGN--KLYMVPM-TGSTIRRALEHGAALRG---------KDSDGGFLQVS 465 
  Fly   466 GIRVVFNSNKPEG------------------QRVVSVQ--VRCAACRVPTYSDLNDTAIYNVVLG 510 
  Fly   511 EFL-LD--GGDGHVMRDSAHQPQRLQNNDL-----EAVSQYLNQRDY 549 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| NT5E-2 | NP_611218.1 | MPP_CD73_N | 33..320 | CDD:277354 | 67/349 (19%) | 
| nadN | 35..520 | CDD:211667 | 111/596 (19%) | ||
| 5_nucleotid_C | 348..519 | CDD:280945 | 39/217 (18%) | ||
| YHR202W | NP_012072.3 | MPP_YHR202W_N | 39..325 | CDD:277352 | 57/310 (18%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C157346067 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG0737 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.830 | |||||