DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NT5E-2 and YHR202W

Sequence 1:NP_611218.1 Gene:NT5E-2 FlyBaseID:FBgn0050104 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_012072.3 Gene:YHR202W SGDID:S000001245 Length:602 Species:Saccharomyces cerevisiae

Alignment Length:632 Identity:119/633 (19%)
Similarity:212/633 (33%) Gaps:198/633 (31%)


  Fly    36 LHNNDMH----ARFDQTSVNSGTCPPEDVHTNKCYGGFARVAHEVR-KYRKEAQEGGTSVLYLNA 95
            :|..|.|    :...|...::.            :|.|......:| |..:::::    |:.::.
Yeast    47 IHTTDTHGWLGSHLSQNDYDAD------------WGDFVAFVDILREKILRQSRD----VIVIDT 95

  Fly    96 GDTYTG-----TSWFTIFKDKIASAFLNKLKPDAISLGNHEFDERVEGLIPFLNEVTFPVLACNL 155
            ||...|     .:|....:   :|...|.:..|.::|||||.......::.:..           
Yeast    96 GDKRDGNGLSDATWPPGLR---SSEIFNMMDYDLLTLGNHELYTAESAILEYRG----------- 146

  Fly   156 DLSKVPQLKATWHLANSAILETNGTKV----GVIGYLTPDTKKLTLNMDVEFN------------ 204
             .|:..:.|..:..:|...:|.:||:|    ..|.:.||..|:..|.:...|:            
Yeast   147 -TSQSSKFKDKYVCSNVEFIEDDGTRVPFGNKYITFETPIMKQRVLALSFLFSFQRANNRAIVTP 210

  Fly   205 --EEVESIN-----VEAKKLKAQGIKIIIALGHSGYLKDLE---------IAKNCPEVDI-VIGG 252
              ||:...:     ||..  :.:.|.:||..||.......|         |.|..|...| ..||
Yeast   211 PLEEITQKSWFQNMVETN--REEEIDLIIVFGHLPATDPTEREMHKIHALIRKYYPNTVIQYFGG 273

  Fly   253 HT-----------NTFLYTGAQPD---------AEHIDGPYPTMVKQ--NSGKEVPVVQAYAYTK 295
            ||           :|.|.:|...:         .:.:|...|...::  :..||       |:..
Yeast   274 HTHIRDFVQLDSKSTCLQSGRFAETVGFLSINMTDPVDAESPIFSRRYIDFNKE-------AFKY 331

  Fly   296 YLGKL-HVQFDADGNLIQWDGSPILLNASVAQEQDLLDLLEVFRPNVTRLEKSVVGHTKVHLEGN 359
            :|.|| |     |.|:      |:    |..:.:.:..|:...|..:...||  :|:.......:
Yeast   332 HLSKLGH-----DSNV------PV----STKKGKTISRLVNDLRHELNLNEK--LGYIPQTYYVS 379

  Fly   360 KAVCRAEECNLGNLIADAMV------------FSRLMEEQGGDFWTDAAISIMQGGGIRSSIEKR 412
            .....:|| ||.:||...::            .||.:              ::..|.:|..:.| 
Yeast   380 TRPLNSEE-NLYHLITHKILPNLIPPKNYEPSMSRFI--------------LINTGSVRYDLYK- 428

  Fly   413 SDGAITDNDILSVLPWGN--KLYMVPM-TGSTIRRALEHGAALRG---------KDSDGGFLQVS 465
              |..|.:....|:|:.|  :...||: ..|.:...|..|..:..         |...|||.:..
Yeast   429 --GPFTKDTEYIVMPFNNDWRFITVPLVVASRVETYLNKGPVIASLGIPSSSHHKQHFGGFQKCP 491

  Fly   466 GIRVVFNSNKPEG------------------QRVVSVQ--VRCAACRVPTYSDLNDTAIYNVVLG 510
            .|.   |.|..||                  ||...:.  |:|...:.....:.:.:.:.:|:..
Yeast   492 FIN---NPNLSEGYTTEDDFGCHGDDTPHNSQREYDIPNVVQCKEVKKVQEEEADPSKMVHVIFY 553

  Fly   511 EFL-LD--GGDGHVMRDSAHQPQRLQNNDL-----EAVSQYLNQRDY 549
            .|: ||  .....::.|...:.:.|..||.     ::..:.|  |||
Yeast   554 SFMELDILNAVNSIINDLGLRMENLTTNDCSHYGGDSTKKLL--RDY 598

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NT5E-2NP_611218.1 MPP_CD73_N 33..320 CDD:277354 67/350 (19%)
nadN 35..520 CDD:211667 111/597 (19%)
5_nucleotid_C 348..519 CDD:280945 39/218 (18%)
YHR202WNP_012072.3 UshA 26..569 CDD:223808 111/600 (19%)
MPP_YHR202W_N 39..325 CDD:277352 57/311 (18%)
5_nucleotid_C <416..>444 CDD:280945 7/31 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C280705479
eggNOG 1 0.900 E1_COG0737
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.