DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NT5E-2 and nt5e

Sequence 1:NP_611218.1 Gene:NT5E-2 FlyBaseID:FBgn0050104 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_957226.1 Gene:nt5e ZFINID:ZDB-GENE-040426-1261 Length:571 Species:Danio rerio

Alignment Length:566 Identity:232/567 (41%)
Similarity:345/567 (61%) Gaps:33/567 (6%)


  Fly    32 EFIILHNNDMHARFDQTSVNSGTC--PPEDVHTNKCYGGFARVAHEVRKYRKEAQEGGTSVLYLN 94
            :..:||.||:|||.::|:.:||.|  ||       |:.|.:|.:.::::.|.:.:    :||.|:
Zfish    26 QLTLLHTNDVHARVEETNKDSGKCSKPP-------CFAGVSRRSTKIKEIRSKEK----NVLLLD 79

  Fly    95 AGDTYTGTSWFTIFKDKIASAFLNKLKPDAISLGNHEFDERVEGLI-PFLNEVTFPVLACNLDLS 158
            |||.:.||.||..:|...|:.|:|:||.||::|||||||..|:||: |||.||...||:.|:...
Zfish    80 AGDQFQGTVWFNYYKGAEAAYFMNQLKYDAMALGNHEFDNGVDGLLKPFLQEVNCTVLSANIKAD 144

  Fly   159 KVPQLKATWHLANSAILETNGTKVGVIGYLTPDTKKLTL-NMDVEFNEEVESINVEAKKLKAQGI 222
            :....:.:.:.....|......||||:||.:.:|..|:| ...::|.:|:.::..:..||...|:
Zfish   145 ETLAPRISGYYFPYKIFTLGSEKVGVVGYTSAETPALSLPGPHLKFEDEITALQPQVDKLLTLGV 209

  Fly   223 KIIIALGHSGYLKDLEIAKNCPEVDIVIGGHTNTFLYTGAQPDAEHIDGPYPTMVKQNSGKEVPV 287
            ..||||||||:|.|..|||....||:|||||||||||||..|..|...||||.|||.:.|::|||
Zfish   210 NKIIALGHSGFLMDQMIAKKVQGVDVVIGGHTNTFLYTGDPPSTEVPAGPYPLMVKSDDGRQVPV 274

  Fly   288 VQAYAYTKYLGKLHVQFDADGNLIQWDGSPILLNASVAQEQDLLDLLEVFRPNVTRLEKSVVGHT 352
            |||||:.||||.|.|.|||:||:::..|:|||||:||..:.|:...::.:|.|:.......||.|
Zfish   275 VQAYAFGKYLGFLKVTFDANGNVLESTGNPILLNSSVEPDPDIQAKVDSWRMNLANYSSQQVGQT 339

  Fly   353 KVHLEGNKAVCRAEECNLGNLIADAMVFSRLM---EEQGGDFWTDAAISIMQGGGIRSSIEKRS- 413
            .|.|.|....||..||||||||.||||...:.   |.|    |...:..|:.|||||..|::|: 
Zfish   340 LVFLNGTFEECRFRECNLGNLICDAMVHHNIKYADELQ----WNHVSSCILNGGGIRGPIDERNR 400

  Fly   414 DGAITDNDILSVLPWGNKLYMVPMTGSTIRRALEHGAALRGKDSDGGFLQVSGIRVVFNSNKPEG 478
            :|:||..|:::|||:|....:|.:.|||:..|.||.....|.:: |.||||||.:||::.:|..|
Zfish   401 NGSITMEDLIAVLPFGGTFDLVQLNGSTLLEAFEHSVRRHGGNT-GEFLQVSGFQVVYDLSKAPG 464

  Fly   479 QRVVSVQVRCAACRVPTYSDLNDTAIYNVVLGEFLLDGGDGHVMRDSAHQPQRLQNN----DLEA 539
            .||.||:|.|..||||.|..|....:|.|||..:|:|||||..|    .:.::|:::    |:..
Zfish   465 SRVKSVKVLCTQCRVPHYEPLVPNKVYKVVLPSYLVDGGDGFTM----IKEKKLKHDSGDLDISV 525

  Fly   540 VSQYLNQRDYVYPEIEGRIIFINASSTLMG-SAALLLISSLLIKII 584
            |:.|:::|..|:|.:|||..|.::.:.|.| ::.:||:.::.:.::
Zfish   526 VAGYISERKRVHPAVEGRFQFSSSCAGLRGYTSTVLLLWAVWLMLV 571

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NT5E-2NP_611218.1 MPP_CD73_N 33..320 CDD:277354 129/291 (44%)
nadN 35..520 CDD:211667 216/493 (44%)
5_nucleotid_C 348..519 CDD:280945 79/175 (45%)
nt5eNP_957226.1 UshA 23..525 CDD:223808 219/519 (42%)
MPP_CD73_N 27..307 CDD:277354 129/291 (44%)
5_nucleotid_C 335..505 CDD:280945 79/175 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C280632556
eggNOG 1 0.900 E1_COG0737
Hieranoid 1 1.000
Homologene 1 1.000 H1895
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D159192at33208
OrthoFinder 1 1.000 FOG0005290
OrthoInspector 1 1.000 T595967
orthoMCL 1 0.900 OOG5_127246
Panther 1 1.100 LDO PTHR11575
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5252
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1211.790

Return to query results.
Submit another query.