DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NT5E-2 and nt5e

Sequence 1:NP_611218.1 Gene:NT5E-2 FlyBaseID:FBgn0050104 Length:585 Species:Drosophila melanogaster
Sequence 2:XP_002933973.1 Gene:nt5e XenbaseID:XB-GENE-984211 Length:578 Species:Xenopus tropicalis

Alignment Length:568 Identity:235/569 (41%)
Similarity:328/569 (58%) Gaps:25/569 (4%)


  Fly    27 PKVAT-EFIILHNNDMHARFDQTSVNSGTC-PPEDVHTNKCYGGFARVAHEVRKYRKEAQEGGTS 89
            |..|| :..|||.||:|||.:||:.:||.| .|:|     ||||.||...::.:.|...:.    
 Frog    18 PSAATLQLTILHTNDVHARVEQTNRDSGKCGDPQD-----CYGGVARRFAKIEEIRSTHRH---- 73

  Fly    90 VLYLNAGDTYTGTSWFTIFKDKIASAFLNKLKPDAISLGNHEFDERVEGLI-PFLNEVTFPVLAC 153
            ||.|:|||.|.||.||..:|...|:.|:|.||.||::|||||||..|.||: |||.||.||:|:.
 Frog    74 VLLLDAGDQYQGTIWFNYYKGHEAAYFMNYLKYDAMALGNHEFDNGVSGLLSPFLQEVKFPILSA 138

  Fly   154 NLDLSKVPQLKATWHLANSAILETNGTKVGVIGYLTPDTKKLT-LNMDVEFNEEVESINVEAKKL 217
            |:...|......|.:.....|||....|:|||||.:.:|..|: ....:.|.:||.::..:..||
 Frog   139 NIKSDKQLAPNITGYYLPYKILEVGTEKIGVIGYSSRETPVLSNSGPHLVFEDEVLALQPQVDKL 203

  Fly   218 KAQGIKIIIALGHSGYLKDLEIAKNCPEVDIVIGGHTNTFLYTGAQPDAEHIDGPYPTMVKQNSG 282
            ...|:..||||||||:..|..||:....:|:|:|||||||||||..|..:...|.||..|..:.|
 Frog   204 LTLGVNKIIALGHSGFETDKLIAQKVKGIDVVVGGHTNTFLYTGPPPSNDVPVGEYPFSVMSDDG 268

  Fly   283 KEVPVVQAYAYTKYLGKLHVQFDADGNLIQWDGSPILLNASVAQEQDLLDLLEVFRPNVTRLEKS 347
            :.||||||||:.||||.|::.||..|.::...|:||||:.|:.::..||..:..::..:......
 Frog   269 RSVPVVQAYAFGKYLGYLNITFDEQGTVVHSFGNPILLDRSIPEDATLLGEVNQWKEAIRNYSSQ 333

  Fly   348 VVGHTKVHLEGNKAVCRAEECNLGNLIADAMVFSRLMEEQGGDFWTDAAISIMQGGGIRSSIEKR 412
            .:|.|.|:|.|:...||..|||:||||.|||:.:.:....... |...::.|:.|||||::|::|
 Frog   334 PIGKTLVYLNGSSLECRNRECNMGNLICDAMIDNNIRHPDEVR-WNHVSLCILNGGGIRAAIDER 397

  Fly   413 -SDGAITDNDILSVLPWGNKLYMVPMTGSTIRRALEHGAALRGKDSDGGFLQVSGIRVVFNSNKP 476
             |:|.||..|::||||:.....::.:.|||::.|.||.....|..: |.||||.||:|||::.|.
 Frog   398 ISNGTITTEDLISVLPFEGTFDLIEIKGSTLKSAFEHSVHRYGSGT-GEFLQVGGIKVVFDTEKS 461

  Fly   477 EGQRVVSVQVRCAACRVPTYSDLNDTAIYNVVLGEFLLDGGDGHVMRDSAHQPQRLQNNDLEAVS 541
            .|||||.::|.|..||||.|..:....||.|||..::..||||..|...........:.||..||
 Frog   462 PGQRVVKLEVICTECRVPKYVPVEMDKIYKVVLPSYIAAGGDGFSMLKDESLKHDSGDTDLTVVS 526

  Fly   542 QYLNQRDYVYPEIEGRIIFIN------ASSTLMGS---AALLLISSLL 580
            .|:.||..|||.:||||.|.|      |:.|.:||   .:||.:.:||
 Frog   527 NYIAQRQRVYPAVEGRITFTNEDSPNGATHTCLGSFPLVSLLTLFALL 574

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NT5E-2NP_611218.1 MPP_CD73_N 33..320 CDD:277354 129/290 (44%)
nadN 35..520 CDD:211667 207/489 (42%)
5_nucleotid_C 348..519 CDD:280945 73/172 (42%)
nt5eXP_002933973.1 UshA 18..547 CDD:223808 226/540 (42%)
MPP_CD73_N 25..306 CDD:277354 129/290 (44%)
5_nucleotid_C 334..504 CDD:280945 73/172 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C280629523
eggNOG 1 0.900 E1_COG0737
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H1895
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D159192at33208
OrthoFinder 1 1.000 FOG0005290
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.720

Return to query results.
Submit another query.