DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30098 and Jon99Fi

Sequence 1:NP_725573.2 Gene:CG30098 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_651800.2 Gene:Jon99Fi FlyBaseID:FBgn0039778 Length:267 Species:Drosophila melanogaster

Alignment Length:241 Identity:56/242 (23%)
Similarity:99/242 (41%) Gaps:39/242 (16%)


  Fly    36 RVIGGQNA--RRTPWMAYLI--RDNRFACGGSLIAYRFVLTAAHCTKINDNLFVRLGEYDSSRTT 96
            |:..|..|  .:.|::..|:  .:..:.||||:|...:||||||||.            .:|..|
  Fly    37 RITNGYPAYEGKVPYIVGLLFSGNGNWWCGGSIIGNTWVLTAAHCTN------------GASGVT 89

  Fly    97 DGQTRSYRVVSIYRH----KNYIDFRNHDIAVLKLDRQVVYDAYIRPICILLNSGLQSLANSIQN 157
            .....|.|....|.|    .|::...:::...|..|..::...::....::....|.|..:..|:
  Fly    90 INYGASLRNQPQYTHWVGSGNFVQHHHYNSGNLHNDISLIRTPHVDFWHLVNKVELPSYNDRYQD 154

  Fly   158 F-----TLTGWGQMAHYYKMPTTLQEMSLRRVRNEYC----GVPSLSICC-WNPVQYACFGDSGG 212
            :     ..:|||.......:|..||.:.::.:....|    .:....||. .|..:..|.|||||
  Fly   155 YAGWWAVASGWGGTYDGSPLPDWLQAVDVQIMSQSDCSRTWSLHDNMICINTNGGKSTCGGDSGG 219

  Fly   213 PLGSLVKYGHKTIYVQFGVTNSV-TGNCDGYSS--YLDLMSYMPWL 255
            ||  :...|::.:    |||:.| :..|...:.  :..:..|:.|:
  Fly   220 PL--VTHEGNRLV----GVTSFVSSAGCQSGAPAVFSRVTGYLDWI 259

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 55/239 (23%)
Tryp_SPc 37..258 CDD:238113 55/241 (23%)
Jon99FiNP_651800.2 Tryp_SPc 37..259 CDD:214473 56/240 (23%)
Tryp_SPc 38..262 CDD:238113 55/241 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C53651
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24260
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.