DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30098 and Jon99Ci

Sequence 1:NP_725573.2 Gene:CG30098 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_524555.1 Gene:Jon99Ci FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster

Alignment Length:217 Identity:62/218 (28%)
Similarity:95/218 (44%) Gaps:34/218 (16%)


  Fly    56 NRFACGGSLIAYRFVLTAAHCTKINDNLFVRLGEYDSSRTTDGQTRSYRVVSIYRHKNYIDFRNH 120
            |.:.||||:|.:.:||||||||...|...:..|..:.:......|.|..  :..|:.:|:.. :|
  Fly    65 NWWWCGGSIIGHTWVLTAAHCTAGADEASLYYGAVNYNEPAFRHTVSSE--NFIRYPHYVGL-DH 126

  Fly   121 DIAVLKLDRQVVYDAYIRPICILLNS----GLQSLANSIQN--FTLTGWGQMAHYYKMPTTLQEM 179
            |:|::|......|.        |:|.    .|....||.:|  ....|||.:.....:...|:.:
  Fly   127 DLALIKTPHVDFYS--------LVNKIELPSLDDRYNSYENNWVQAAGWGAIYDGSNVVEDLRVV 183

  Fly   180 SLRRVR----NEYCGVPSLS---ICCWNPVQYA-CFGDSGGPLGSLVKYGHKTIYVQFGVTNSVT 236
            .|:.:.    ..|.|..:.|   ||...|...| |.|||||||  :.|.|.|.|    |:|:.|:
  Fly   184 DLKVISVAECQAYYGTDTASENTICVETPDGKATCQGDSGGPL--VTKEGDKLI----GITSFVS 242

  Fly   237 G-NCD--GYSSYLDLMSYMPWL 255
            . .|.  |.:.:..:..|:.|:
  Fly   243 AYGCQVGGPAGFTRVTKYLEWI 264

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 61/215 (28%)
Tryp_SPc 37..258 CDD:238113 62/218 (28%)
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 62/216 (29%)
Tryp_SPc 41..266 CDD:238113 62/218 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C52140
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24260
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.