DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30098 and CG9649

DIOPT Version :9

Sequence 1:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster


Alignment Length:251 Identity:70/251 - (27%)
Similarity:113/251 - (45%) Gaps:35/251 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 IRVIGGQNARRTPWMAYLI----RDNRFACGGSLIAYRFVLTAAHCTKI------NDNLFVRLGE 89
            |.|..||    .||||.|.    ||..|.|||:||:.|.|::||||.:.      .:...|.||.
  Fly   261 IEVERGQ----LPWMAALFEHVGRDYNFLCGGTLISARTVISAAHCFRFGSRNLPGERTIVSLGR 321

  Fly    90 YDSSRTTDGQTRSYRVVSIYRHKNYIDFRNHDIAVLKLDRQVVYDAYIRPICILLNSGLQSLANS 154
            ......:.|.|.....:.|:...|...:.:.|:|:|:|...|....||:|||:...:.|..|.:.
  Fly   322 NSLDLFSSGATLGVARLLIHEQYNPNVYTDADLALLQLSNHVDIGDYIKPICLWNENFLLELPSG 386

  Fly   155 IQNFTLTGWGQ------MAHYYKMPTT--LQEMSLRRVRNEYCG--VPSLSICCWN-PVQYACFG 208
            .::: :.|||:      .....||..|  :.:...|...:|...  :.|.:||..| .....|.|
  Fly   387 HKSY-VAGWGEDEKGNRNTRLAKMTDTDIITQWECRGNLSEENAKFITSHTICASNAQASGPCSG 450

  Fly   209 DSGGPLGSLVKYGHKTIYVQFGVTNS---VTGNCDGYSS--YLDLMSYMPWLYQTL 259
            ||||  |.:::  .:.|::..||.::   :|..|:....  |.|:..::.||..::
  Fly   451 DSGG--GLMLQ--EQDIWMLRGVVSAGQRMTNRCNLTLPVIYTDVAKHIEWLLSSM 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 67/243 (28%)
Tryp_SPc 37..258 CDD:238113 69/246 (28%)
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 68/245 (28%)
Tryp_SPc 259..497 CDD:214473 68/244 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436612
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.