DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30098 and CG13318

Sequence 1:NP_725573.2 Gene:CG30098 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_649831.1 Gene:CG13318 FlyBaseID:FBgn0037627 Length:405 Species:Drosophila melanogaster

Alignment Length:251 Identity:64/252 (25%)
Similarity:110/252 (44%) Gaps:60/252 (24%)


  Fly    47 PWMAYLIRD-NRFACGGSLIAYRFVLTAAHCTKINDNL-----FVRLGEYDSSRTTDG-QTRSYR 104
            ||.|.|:.. :.:..||:||..:.||||||  |:. ||     .|||||:|::.|::. ..:...
  Fly   175 PWQAALLTTADVYLGGGALITAQHVLTAAH--KVY-NLGLTYFKVRLGEWDAASTSEPIPAQDVY 236

  Fly   105 VVSIYRHKNY--IDFRNHDIAVLKLDRQV--VYDAYIRPICILLNSGLQSLANSIQNFTLTGWGQ 165
            :.::|.:.::  .:.:| |:|:|||...|  ...:.:..:|:...|.:.      |...:.|||:
  Fly   237 ISNVYVNPSFNPNNLQN-DVAILKLSTPVSLTSKSTVGTVCLPTTSFVG------QRCWVAGWGK 294

  Fly   166 ----MAHYYK----------MPTTLQEMSLR--RVRNEYCGVPSLSICCWNPV-QYACFGDSGGP 213
                ....|:          :|....:.:|:  |:.:.:...|:..||..... :.||.||.|.|
  Fly   295 NDFGATGAYQAIERQVDVPLIPNANCQAALQATRLGSSFVLSPTSFICAGGEAGKDACTGDGGSP 359

  Fly   214 L----------GSLVKYGHKTIYVQFGVTNSVTGNCDGYSSYLDLMSYMPWLYQTL 259
            |          ..||.:|...  .|.||.          ..|:::.:|:||:..||
  Fly   360 LVCTSNGVWYVVGLVAWGIGC--AQAGVP----------GVYVNVGTYLPWIQTTL 403

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 61/245 (25%)
Tryp_SPc 37..258 CDD:238113 62/249 (25%)
CG13318NP_649831.1 Tryp_SPc 169..402 CDD:238113 62/249 (25%)
Tryp_SPc 169..399 CDD:214473 62/246 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C54239
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24260
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.