DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30098 and CG13318

DIOPT Version :9

Sequence 1:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_649831.1 Gene:CG13318 / 41048 FlyBaseID:FBgn0037627 Length:405 Species:Drosophila melanogaster


Alignment Length:251 Identity:64/251 - (25%)
Similarity:110/251 - (43%) Gaps:60/251 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 PWMAYLIRD-NRFACGGSLIAYRFVLTAAHCTKINDNL-----FVRLGEYDSSRTTDG-QTRSYR 104
            ||.|.|:.. :.:..||:||..:.||||||  |:. ||     .|||||:|::.|::. ..:...
  Fly   175 PWQAALLTTADVYLGGGALITAQHVLTAAH--KVY-NLGLTYFKVRLGEWDAASTSEPIPAQDVY 236

  Fly   105 VVSIYRHKNY--IDFRNHDIAVLKLDRQV--VYDAYIRPICILLNSGLQSLANSIQNFTLTGWGQ 165
            :.::|.:.::  .:.:| |:|:|||...|  ...:.:..:|:...|.:.      |...:.|||:
  Fly   237 ISNVYVNPSFNPNNLQN-DVAILKLSTPVSLTSKSTVGTVCLPTTSFVG------QRCWVAGWGK 294

  Fly   166 ----MAHYYK----------MPTTLQEMSLR--RVRNEYCGVPSLSICCWNPV-QYACFGDSGGP 213
                ....|:          :|....:.:|:  |:.:.:...|:..||..... :.||.||.|.|
  Fly   295 NDFGATGAYQAIERQVDVPLIPNANCQAALQATRLGSSFVLSPTSFICAGGEAGKDACTGDGGSP 359

  Fly   214 L----------GSLVKYGHKTIYVQFGVTNSVTGNCDGYSSYLDLMSYMPWLYQTL 259
            |          ..||.:|...  .|.||.          ..|:::.:|:||:..||
  Fly   360 LVCTSNGVWYVVGLVAWGIGC--AQAGVP----------GVYVNVGTYLPWIQTTL 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 60/244 (25%)
Tryp_SPc 37..258 CDD:238113 62/248 (25%)
CG13318NP_649831.1 Tryp_SPc 169..402 CDD:238113 62/248 (25%)
Tryp_SPc 169..399 CDD:214473 61/245 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435550
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.