DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30098 and MP1

Sequence 1:NP_725573.2 Gene:CG30098 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001303421.1 Gene:MP1 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster

Alignment Length:275 Identity:81/276 (29%)
Similarity:118/276 (43%) Gaps:58/276 (21%)


  Fly    29 CIALFRIRVIGGQNA--RRTPWMAYL-------IRDNRFACGGSLIAYRFVLTAAHCTKINDNLF 84
            |...|..||:||...  |..||||.:       ::.:.  ||||||.:|:|||||||.....:.:
  Fly   130 CGENFGDRVVGGNETTKREFPWMALIEYTKPGNVKGHH--CGGSLINHRYVLTAAHCVSAIPSDW 192

  Fly    85 ----VRLGEYDSSRTTD---GQTR---------SYRVVSIYRHKNYI-DFRN--HDIAVLKLDRQ 130
                |||||:|:|...|   |:..         .|.|.....|..|. :.|:  :|||:|:|..:
  Fly   193 ELTGVRLGEWDASTNPDCTVGKNGRRDCNEPYVDYPVEERIPHPQYPGNSRDQLNDIALLRLRDE 257

  Fly   131 VVYDAYIRPICILLNSGLQSLANSIQNFTL------TGWGQMAHYY----KMPTTLQEMSLRRVR 185
            |.|..:|.|:|      |.:||:...|..|      .|||:....:    |:...|..:......
  Fly   258 VQYSDFILPVC------LPTLASQHNNIFLGRKVVVAGWGRTETNFTSNIKLKAELDTVPTSECN 316

  Fly   186 NEYC----GVPSLSICCWNPVQY-ACFGDSGGPLGSLVKY--GHKTIYVQFGVTNSVTGNC--DG 241
            ..|.    .|.:..:|....... :|.||||||| .|..|  |:...|:. ||.:.....|  .|
  Fly   317 QRYATQRRTVTTKQMCAGGVEGVDSCRGDSGGPL-LLEDYSNGNSNYYIA-GVVSYGPTPCGLKG 379

  Fly   242 YSS-YLDLMSYMPWL 255
            :.. |..:.:|:.|:
  Fly   380 WPGVYTRVEAYLNWI 394

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 78/266 (29%)
Tryp_SPc 37..258 CDD:238113 78/268 (29%)
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 79/267 (30%)
Tryp_SPc 138..397 CDD:238113 78/268 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C159553629
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24260
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.