| Sequence 1: | NP_725573.2 | Gene: | CG30098 / 246456 | FlyBaseID: | FBgn0050098 | Length: | 264 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_649100.2 | Gene: | CG14088 / 40098 | FlyBaseID: | FBgn0036858 | Length: | 289 | Species: | Drosophila melanogaster |
| Alignment Length: | 264 | Identity: | 73/264 - (27%) |
|---|---|---|---|
| Similarity: | 116/264 - (43%) | Gaps: | 36/264 - (13%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 5 IVLLTFLVILTLGSYGYSQLLDSKCIALFRIRVIGGQNARRT--------PWMAYLIRDNRFACG 61
Fly 62 GSLIAYRFVLTAAHCTKINDNLFV---RLGEYDSSRTTDGQTRSYRVVSIYRHKNY-IDFRNHDI 122
Fly 123 AVLKLDRQVVYDAYIRPICILLNSGLQSLANSIQNFTLTGWGQMAHYYKMPTTLQEMSLRRVRNE 187
Fly 188 YCG-VPSLSICCWNPVQYACFGDSGGPLGSLVKYGHKTIYVQFGVTNSVTGNCDGYSSYLDLMSY 251
Fly 252 MPWL 255 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG30098 | NP_725573.2 | Tryp_SPc | 36..254 | CDD:214473 | 63/230 (27%) |
| Tryp_SPc | 37..258 | CDD:238113 | 64/232 (28%) | ||
| CG14088 | NP_649100.2 | Tryp_SPc | 42..251 | CDD:304450 | 62/217 (29%) |
| Tryp_SPc | 42..248 | CDD:214473 | 61/215 (28%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 1 | 1.000 | - | - | FOG0000404 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR24260 |
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 3.010 | |||||