DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30098 and CG8329

DIOPT Version :9

Sequence 1:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster


Alignment Length:234 Identity:60/234 - (25%)
Similarity:101/234 - (43%) Gaps:33/234 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 VIGGQNA--RRTPWMAYLIRDNRFACGGSLIAYRFVLTAAHCTKINDNLFVRLGEYDSSRTTDGQ 99
            ::.|..|  .:.|:...|..:|....|||:|...:|||||||. ..|::.:   .|.|:|..:||
  Fly    35 IVNGYPAYEGKAPYAVGLRMNNGAVGGGSVIGNNWVLTAAHCL-TTDSVTI---HYGSNRAWNGQ 95

  Fly   100 TR-SYRVVSIYRHKNYIDFRNHDIAVLKLDRQVVYDAYIRPICILLNSGLQSLANSIQNF----- 158
            .: :....:.:||..|.:...|||.:::       ..|:....::....|...:...:.|     
  Fly    96 LQHTVNKNNFFRHPGYPNSAGHDIGLIR-------TPYVSFTNLINKVSLPKFSQKGERFENWWC 153

  Fly   159 TLTGWGQMAHYYKMPTTLQEMSLRRVRNEYC-----GVPSLSICC-WNPVQYACFGDSGGPLGSL 217
            ...|||.||: ..:...||.|.::.:.|..|     .|.|..:|. ....:..|.||||   |:|
  Fly   154 VACGWGGMAN-GGLADWLQCMDVQVISNGECARSYGSVASTDMCTRATDGKSVCGGDSG---GAL 214

  Fly   218 VKYGHKTIYVQFGVTNSVTGNC-DGYSSYLDLMSYMPWL 255
            |.:.:.   :|.||....:..| .|.|.|..:..::.|:
  Fly   215 VTHDNP---IQVGVITFASIGCKSGPSGYTRVSDHLDWI 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 59/231 (26%)
Tryp_SPc 37..258 CDD:238113 60/234 (26%)
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 60/234 (26%)
Tryp_SPc 35..250 CDD:214473 59/232 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435919
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.