DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30098 and CG8329

Sequence 1:NP_725573.2 Gene:CG30098 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_648339.1 Gene:CG8329 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster

Alignment Length:234 Identity:60/235 (26%)
Similarity:101/235 (43%) Gaps:33/235 (14%)


  Fly    37 VIGGQNA--RRTPWMAYLIRDNRFACGGSLIAYRFVLTAAHCTKINDNLFVRLGEYDSSRTTDGQ 99
            ::.|..|  .:.|:...|..:|....|||:|...:|||||||. ..|::.:   .|.|:|..:||
  Fly    35 IVNGYPAYEGKAPYAVGLRMNNGAVGGGSVIGNNWVLTAAHCL-TTDSVTI---HYGSNRAWNGQ 95

  Fly   100 TR-SYRVVSIYRHKNYIDFRNHDIAVLKLDRQVVYDAYIRPICILLNSGLQSLANSIQNF----- 158
            .: :....:.:||..|.:...|||.:::       ..|:....::....|...:...:.|     
  Fly    96 LQHTVNKNNFFRHPGYPNSAGHDIGLIR-------TPYVSFTNLINKVSLPKFSQKGERFENWWC 153

  Fly   159 TLTGWGQMAHYYKMPTTLQEMSLRRVRNEYC-----GVPSLSICC-WNPVQYACFGDSGGPLGSL 217
            ...|||.||: ..:...||.|.::.:.|..|     .|.|..:|. ....:..|.||||   |:|
  Fly   154 VACGWGGMAN-GGLADWLQCMDVQVISNGECARSYGSVASTDMCTRATDGKSVCGGDSG---GAL 214

  Fly   218 VKYGHKTIYVQFGVTNSVTGNC-DGYSSYLDLMSYMPWL 255
            |.:.:.   :|.||....:..| .|.|.|..:..::.|:
  Fly   215 VTHDNP---IQVGVITFASIGCKSGPSGYTRVSDHLDWI 250

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 59/232 (25%)
Tryp_SPc 37..258 CDD:238113 60/235 (26%)
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 60/235 (26%)
Tryp_SPc 35..250 CDD:214473 60/233 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C53519
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24260
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.