DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30098 and CG3088

Sequence 1:NP_725573.2 Gene:CG30098 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_648334.1 Gene:CG3088 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster

Alignment Length:213 Identity:49/214 (23%)
Similarity:92/214 (43%) Gaps:36/214 (17%)


  Fly    60 CGGSLIAYRFVLTAAHCTKINDNLFVRLGEYDSSRTTDGQTRSYRVVSIYRHKNYIDFRNHDIAV 124
            |.|::|...::||:|.|...:..:.:..|   ::|.:..|.    .|:: ....|:....| :|:
  Fly    55 CSGTIIGDTWILTSAQCLTGSSGVTIYFG---ATRLSQAQF----TVTV-GTSEYVTGNQH-LAL 110

  Fly   125 LKLDRQVVYDAYIRPICILLNSGLQSLANSIQNF-----TLTGWGQMAHYYKMPTTLQEMSLRRV 184
            :::.| |.:...:..:      .|.||.|..|.:     .:.|||.......:...||.:.|:.:
  Fly   111 VRVPR-VGFSNRVNRV------ALPSLRNRSQRYENWWANVCGWGVTTFSNGLTDALQCVDLQIM 168

  Fly   185 RNEYC----GVPSLS---ICCWNPV-QYACFGDSGGPLGSLVKYGHKTIYVQ-FGVTNSVT-GNC 239
            .|..|    |..::|   :|...|. :..||||:|.||  :.|.....:.:. |..:|..| |..
  Fly   169 SNNECIAFYGSTTVSDQILCTRTPSGRSTCFGDAGSPL--ITKQDSTVVGISAFVASNGCTLGLP 231

  Fly   240 DGYSSYLDLMSYMPWLYQ 257
            .|::.   :.|.:.|::|
  Fly   232 AGFAR---ITSALDWIHQ 246

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 47/209 (22%)
Tryp_SPc 37..258 CDD:238113 49/214 (23%)
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 48/212 (23%)
Tryp_SPc 29..244 CDD:214473 48/210 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C52206
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24260
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.