DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30098 and sphinx2

Sequence 1:NP_725573.2 Gene:CG30098 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001303408.1 Gene:sphinx2 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster

Alignment Length:259 Identity:53/260 (20%)
Similarity:98/260 (38%) Gaps:77/260 (30%)


  Fly    36 RVIGGQNARRTPW-MAYLI---------RDNRFACGGSLIAYRFVLTAAHCTKINDNLFVRLGE- 89
            |:.||..|:  |: :.||:         ...:|. .|::|:.:::||      :.:.|..:..| 
  Fly    25 RITGGYRAK--PYTIIYLVGIVYAKSPLSSLKFG-AGTIISNQWILT------VKEVLIFKYIEA 80

  Fly    90 -YDSSRTTDGQTRSYRVVSIYRHKNYIDFRNHDIAVL------KLDRQV------VYDAYIRPIC 141
             :.|.|...|    |.::.|||...|..:....|..|      |.||::      .|.|      
  Fly    81 HFGSKRAFWG----YDILRIYRENFYFHYDKTRIIALVKCPYQKFDRRMSRVRVPAYGA------ 135

  Fly   142 ILLNSGLQSLANSIQNFTLT-GWGQMAHYYKMPTTLQEMSLRRVRNEYCGVPSLSICCWNPVQY- 204
                    .....:.|.|:. |||......::||.::.:.:..:.|..|..      ...|::: 
  Fly   136 --------RFERYVGNMTMVCGWGTDKRKVRLPTWMRCVEVEVMNNTECAK------YHTPLKWY 186

  Fly   205 -----------ACFGDSGGPLGSLVKYGHKTIYVQFGVTNSVTGNCD-GYSS-YLDLMSYMPWL 255
                       .|.||.|   |::|..|....::  |:...:..||. ||.| ::.:..::.|:
  Fly   187 EMCTSGEGFKGVCEGDMG---GAVVTMGPNPTFI--GIIWLMPTNCSIGYPSVHIRVSDHIKWI 245

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 52/257 (20%)
Tryp_SPc 37..258 CDD:238113 52/259 (20%)
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 53/258 (21%)
Tryp_SPc 26..248 CDD:304450 52/259 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C52541
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24260
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.