DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30098 and Jon65Aii

Sequence 1:NP_725573.2 Gene:CG30098 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_648014.1 Gene:Jon65Aii FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster

Alignment Length:260 Identity:64/261 (25%)
Similarity:101/261 (39%) Gaps:84/261 (32%)


  Fly    36 RVIGGQNA--RRTPWMAYLIRDN----RFACGGSLIAYRFVLTAAHCTKINDNLFVRLGEYDSSR 94
            |:..|..|  .:.|::..|..||    .:.||||:|.:.:||||||||            |.:|.
  Fly    36 RITNGYPAYEGKVPYIVALRFDNGNGGGWYCGGSIIGHEWVLTAAHCT------------YGASY 88

  Fly    95 TTDGQTRSYRVVSIYRHKNYIDFRNHDIAVLKLDRQVVYDAYIRPICILLNSGLQSLANSIQ--- 156
            .|......:|....:.|.:..:..| |||:::..                :....||.|.::   
  Fly    89 VTISYGAVWRQQPQFTHYDTGNLHN-DIALIRTP----------------HVDFWSLVNKVELPR 136

  Fly   157 ------NF-----TLTGWGQMAHYYKMPTTLQEMSLRRVRNEYC-------GVPSLSICCWNPV- 202
                  ||     .|:|||..:....|...|..:.::...|..|       .:.|..:|...|. 
  Fly   137 YDDRYNNFYGWWALLSGWGSSSDSSGMTDYLNCVDIQISDNSVCLDYYGSHYITSNHLCYATPEN 201

  Fly   203 QYACFGDSGGPLGSLVKYGHKTI-YVQFG-----VTNS------VTGNCDGYSSYLDLMSYMPWL 255
            :.:|.|||||||  ::..|::.: .|.||     ::||      |||             |:.|:
  Fly   202 KGSCSGDSGGPL--VLHDGNRQVGIVSFGSAAGCLSNSPKGLTRVTG-------------YLDWI 251

  Fly   256  255
              Fly   252  251

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 63/258 (24%)
Tryp_SPc 37..258 CDD:238113 63/260 (24%)
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 64/259 (25%)
Tryp_SPc 37..254 CDD:238113 63/260 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C53684
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24260
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.