DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30098 and Jon65Aiii

Sequence 1:NP_725573.2 Gene:CG30098 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_648013.1 Gene:Jon65Aiii FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster

Alignment Length:283 Identity:73/284 (26%)
Similarity:127/284 (45%) Gaps:52/284 (18%)


  Fly     6 VLLTFLVILTLGSYGYSQLL---------DSKCIALFRIRVIGGQNAR--RTPW---MAYLIRDN 56
            ||:.|.:.|...|.|   ||         |...:.....|:..|:.|.  :.|:   :::.....
  Fly     3 VLVVFALALATASAG---LLPQQVPIHPRDLPAVTNIEGRITNGKTATSGQFPYQVGLSFASTSG 64

  Fly    57 RFACGGSLIAYRFVLTAAHCTKINDNLFVRLGEYDSSRTTDGQTRSYRVVSIYRHKNY--IDFRN 119
            .:.||||:|...:||||||||.....:.:..|.  :.||:....::....:..:|.:|  |..||
  Fly    65 SWWCGGSIIDNTWVLTAAHCTSGASAVTIYYGA--TVRTSAQLVQTVSADNFVQHASYNSIVLRN 127

  Fly   120 HDIAVLKLDRQVVYDAYIRPICILLNSGLQSLANSIQNFT-----LTGWGQMA-HYYKMPTTLQ- 177
             ||:::|.. .|.:.|.|..:      .|.::|.:...:|     .:|||:.: ....:..||| 
  Fly   128 -DISLIKTP-TVAFTALINKV------ELPAIAGTYSTYTGQQAIASGWGKTSDSATSVANTLQY 184

  Fly   178 ----EMSLRRVRNEYCGVPSLS--ICCWNPVQYA-CFGDSGGPLGSLVKYGHKTIYVQFGVTNSV 235
                .:|:.:.:|.|..:.:.:  ||...|.:.: |.|||||||  ::....|.|    |||:.|
  Fly   185 EVFEVVSVSQCQNTYGSLVATNNVICVATPNKVSTCNGDSGGPL--VLVSDSKLI----GVTSFV 243

  Fly   236 -TGNCD--GYSSYLDLMSYMPWL 255
             :..|:  ..:.:..:.||:.|:
  Fly   244 SSAGCESGAPAGFTRVTSYLDWI 266

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 63/242 (26%)
Tryp_SPc 37..258 CDD:238113 63/244 (26%)
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 64/243 (26%)
Tryp_SPc 40..269 CDD:238113 63/244 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C53321
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24260
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.