DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30098 and yip7

Sequence 1:NP_725573.2 Gene:CG30098 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_523944.1 Gene:yip7 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster

Alignment Length:223 Identity:58/224 (26%)
Similarity:96/224 (43%) Gaps:47/224 (21%)


  Fly    60 CGGSLIAYRFVLTAAHCTKINDNLFVRLGEYDSSRTTDGQTRSYRVVSIYRHKNY--IDFRNHDI 122
            ||||:|...:||||||||....::.:..|.  :.||:...|:........:|::|  :..|| ||
  Fly    68 CGGSIIGNEWVLTAAHCTDGAASVTIYYGA--TVRTSPEFTQVVSSSKFRQHESYLALTIRN-DI 129

  Fly   123 AVLKLDRQVVYDAYIRPICILLNSGLQSLANSIQNF-----TLTGWGQMA-HYYKMPTTLQEMSL 181
            ::::.. .|.:.|.:..|      .|.:::||...:     ..:|||..: ....:...||.:.|
  Fly   130 SLIQTS-SVSFSATVNKI------SLPAVSNSYSTYEGKTAVASGWGLTSDQATAVSRDLQYVDL 187

  Fly   182 RRVRNEYCG------VPSLSICCWNPVQYA--CFGDSGGPL---GSLVKYGHKTIYVQFGVTNSV 235
            ..:.|..|.      :.:..:.|.:....|  |.|||||||   |.|:           |.|:  
  Fly   188 TIISNSKCQETFGSLIVTSRVLCVDTTNKASTCQGDSGGPLALDGVLI-----------GATS-- 239

  Fly   236 TGNCDGYSS-----YLDLMSYMPWLYQT 258
            .|:.||..|     :..:..|..|:.:|
  Fly   240 FGSADGCESGAPAAFTRITYYRDWIKET 267

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 56/218 (26%)
Tryp_SPc 37..258 CDD:238113 57/222 (26%)
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 57/219 (26%)
Tryp_SPc 40..267 CDD:238113 57/222 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C53585
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24260
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.