DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30098 and CG30283

Sequence 1:NP_725573.2 Gene:CG30098 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_611587.2 Gene:CG30283 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster

Alignment Length:268 Identity:87/269 (32%)
Similarity:141/269 (52%) Gaps:19/269 (7%)


  Fly     5 IVLLTFLVILTLGSYGYSQLLDSKC--IALFRIRVIGGQNA--RRTPWMAYLIRDNRFACGGSLI 65
            :|||....::.|||...| .|:..|  :.:.:.:::||.||  ...||||.::.:..|.|||:||
  Fly    10 VVLLAASSVVVLGSESGS-FLEHPCGTVPISQFKILGGHNAPVASAPWMAMVMGEGGFHCGGTLI 73

  Fly    66 AYRFVLTAAHCTKINDNLFVRLGEYDSSRTTDGQTRSYRVVSIYRHKNYIDFRNHDIAVLKLDRQ 130
            ..|||||:|||. .|..|.||||..:    .:.:.:.:.|.:::.|.:|. |..||:|:|:|.::
  Fly    74 TNRFVLTSAHCI-ANGELKVRLGVLE----REAEAQKFAVDAMFVHTDYY-FDQHDLALLRLAKR 132

  Fly   131 VVYDAYIRPICILLNSGLQSLANSIQNFTLTGWGQMAHYYKMPTTLQEMSLRRVRNEYCG----- 190
            |.|...|.|||:||:..::::...|..|...|||: .........||:.||..:....|.     
  Fly   133 VHYSDNISPICLLLDPLVKNIDEHIVKFRTYGWGK-TESRSSSRMLQKTSLFNLHRSECAKQYPH 196

  Fly   191 --VPSLSICCWNPVQYACFGDSGGPLGSLVKYGHKTIYVQFGVTNSVTGNCDGYSSYLDLMSYMP 253
              :....||..:.....|.|||||||.::|.|.|..:..|||||:....:|...:.:.::|:::.
  Fly   197 QQINRNHICAESANANTCNGDSGGPLTAIVTYDHVQMVFQFGVTSFGHADCSKATVFTNVMTHLD 261

  Fly   254 WLYQTLLR 261
            |:..|:.|
  Fly   262 WIVNTVRR 269

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 75/227 (33%)
Tryp_SPc 37..258 CDD:238113 76/230 (33%)
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 76/228 (33%)
Tryp_SPc 43..266 CDD:238113 76/230 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24260
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.