DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30098 and CG10764

DIOPT Version :9

Sequence 1:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster


Alignment Length:272 Identity:84/272 - (30%)
Similarity:139/272 - (51%) Gaps:20/272 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AIVLLTFLVILTL--GSYGYSQLLDSKCIALFRIRVIGGQNAR--RTPWMAYLIRDNRFACGGSL 64
            ::|.:..|.:|||  ....:.:.|::.|....|.::.||.:|.  .:.|||.:...:.|.|||::
  Fly     3 SLVSVALLSLLTLCVTENEHFKFLETPCGISTRPKISGGDDAAEPNSIWMAAIFNSSDFQCGGTI 67

  Fly    65 IAYRFVLTAAHCTKINDNLFVRLGEYDSSRTTDGQTRSYRVVSIYRHKNYI--DFRNHDIAVLKL 127
            |..||||:||||.....:|:||||    :|..:.....:.|::::.|.::|  ::|| ||.:|:|
  Fly    68 IHMRFVLSAAHCLVRGYDLYVRLG----ARNINEPAAVHTVINVFVHHDFIASEYRN-DIGLLQL 127

  Fly   128 DRQVVYDAYIRPICILLNSGLQSLANSIQNFTLTGWGQMAHYYKMPTTLQEMSLRRVRNEYC--- 189
            ...:||...::||||.|:..|:.....::.|...|||.  ...|:...||.:.|..::...|   
  Fly   128 SESIVYTVRVQPICIFLDPALKGSVEKLKTFRALGWGN--RNGKLSIMLQTIYLLHLKRNECKRK 190

  Fly   190 ---GVPSLSICCWNPVQYACFGDSGGPLGSLVKY-GHKTIYVQFGVTNSVTGNCDGYSSYLDLMS 250
               .:.|..||........|.|||||||.:.:.: .:|:..||.|:.:.....|.|...|.|:.|
  Fly   191 LNFNLNSRQICAGTKNGDTCRGDSGGPLSTNILFPSNKSYEVQLGIVSFGDPECRGVGVYTDVTS 255

  Fly   251 YMPWLYQTLLRN 262
            |:.|:..|:.||
  Fly   256 YVDWISSTIARN 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 72/228 (32%)
Tryp_SPc 37..258 CDD:238113 73/231 (32%)
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 72/229 (31%)
Tryp_SPc 38..263 CDD:238113 73/231 (32%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463247
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
65.840

Return to query results.
Submit another query.