DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30098 and CG10764

DIOPT Version :9

Sequence 1:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster


Alignment Length:272 Identity:84/272 - (30%)
Similarity:139/272 - (51%) Gaps:20/272 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AIVLLTFLVILTL--GSYGYSQLLDSKCIALFRIRVIGGQNAR--RTPWMAYLIRDNRFACGGSL 64
            ::|.:..|.:|||  ....:.:.|::.|....|.::.||.:|.  .:.|||.:...:.|.|||::
  Fly     3 SLVSVALLSLLTLCVTENEHFKFLETPCGISTRPKISGGDDAAEPNSIWMAAIFNSSDFQCGGTI 67

  Fly    65 IAYRFVLTAAHCTKINDNLFVRLGEYDSSRTTDGQTRSYRVVSIYRHKNYI--DFRNHDIAVLKL 127
            |..||||:||||.....:|:||||    :|..:.....:.|::::.|.::|  ::|| ||.:|:|
  Fly    68 IHMRFVLSAAHCLVRGYDLYVRLG----ARNINEPAAVHTVINVFVHHDFIASEYRN-DIGLLQL 127

  Fly   128 DRQVVYDAYIRPICILLNSGLQSLANSIQNFTLTGWGQMAHYYKMPTTLQEMSLRRVRNEYC--- 189
            ...:||...::||||.|:..|:.....::.|...|||.  ...|:...||.:.|..::...|   
  Fly   128 SESIVYTVRVQPICIFLDPALKGSVEKLKTFRALGWGN--RNGKLSIMLQTIYLLHLKRNECKRK 190

  Fly   190 ---GVPSLSICCWNPVQYACFGDSGGPLGSLVKY-GHKTIYVQFGVTNSVTGNCDGYSSYLDLMS 250
               .:.|..||........|.|||||||.:.:.: .:|:..||.|:.:.....|.|...|.|:.|
  Fly   191 LNFNLNSRQICAGTKNGDTCRGDSGGPLSTNILFPSNKSYEVQLGIVSFGDPECRGVGVYTDVTS 255

  Fly   251 YMPWLYQTLLRN 262
            |:.|:..|:.||
  Fly   256 YVDWISSTIARN 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 37..258 CDD:238113 73/231 (32%)
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 72/229 (31%)
Tryp_SPc 317..512 CDD:473915
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Software error:

Can't use an undefined value as an ARRAY reference at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 1034.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - -
Domainoid 1 1.000 - -
eggNOG 00.000 Not matched by this tool.