DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30098 and CG17572

Sequence 1:NP_725573.2 Gene:CG30098 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_609941.2 Gene:CG17572 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster

Alignment Length:235 Identity:61/236 (26%)
Similarity:106/236 (45%) Gaps:49/236 (21%)


  Fly    58 FACGGSLIAYRFVLTAAHC--TKINDNLF--VRLGEYDSSRTTD--------GQTRSYRVVSIYR 110
            :.|.|::||.|.:||||||  .|.:.:..  ||:||||:|...|        .::.::.:..:..
  Fly   158 YPCAGAVIARRVILTAAHCALAKADGHRLSSVRVGEYDTSSDPDCANTGFCAPRSVNHAISHVIV 222

  Fly   111 HKNYIDFR-NHDIAVLKLDRQVVYDAYIRPICILLNSGLQSLANSI--QNFTLTGWGQMA----- 167
            |.:|...: :||||:|.|...:.|....:|||:     .::.||.:  :..|:.|||:|:     
  Fly   223 HPDYKQGQYHHDIALLVLKTPLNYSVATQPICL-----QKTRANLVVGKRATIAGWGKMSTSSVR 282

  Fly   168 ----HYYKMPTTLQEMSLRRVRNEYCGVPSLS---------ICCWNPVQYACFGDSGGPLGSLVK 219
                .:..:|.|..::.||    .|....:|.         :|.....:..|.|..|.|| .:.:
  Fly   283 QPEMSHLDVPLTSWDLCLR----NYGSTGALESPNSIEGQWMCAGGEGKDVCQGFGGAPL-FIQE 342

  Fly   220 YGHKTIYVQFGVTNSVTGNCDGY---SSYLDLMSYMPWLY 256
            .|   |:.|.|:.:..:.||.|.   |.|..:..:..|::
  Fly   343 NG---IFSQIGIMSFGSDNCGGLRIPSVYTSVAHFSEWIH 379

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 60/232 (26%)
Tryp_SPc 37..258 CDD:238113 61/236 (26%)
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 61/236 (26%)
Tryp_SPc 138..378 CDD:214473 61/233 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24260
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.