DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30098 and CG9377

DIOPT Version :10

Sequence 1:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster


Alignment Length:250 Identity:61/250 - (24%)
Similarity:99/250 - (39%) Gaps:64/250 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 PWMAYLIRDNRFACGGSLIAYRFVLTAAHCTKINDNLFVRL--GEYDSSRTTDGQTRSYR-VVSI 108
            ||:..:...:.:.|.|:||....|:|.|||.:.::...|||  ||:|::...:.|....| ||..
  Fly   113 PWLVAVYGSDTYLCSGALITPLAVITTAHCVQNSEMEKVRLLAGEWDAAVELEPQPHQQRSVVET 177

  Fly   109 YRHKNYIDF-RNHDIAVLKLDRQVVYD--AYIRPICILLNSGLQSLANSIQNFTLTGW-----GQ 165
            ..|.||... ..|:||:|.:|::..:.  ..::|||:   ...:.:.|..|.: ::||     |:
  Fly   178 LVHPNYTQMPLAHNIAILLVDKEKPFQLAPNVQPICL---PPPRIMYNYSQCY-VSGWQRSDFGR 238

  Fly   166 MA------HYYKMP----TTLQEMSL---RRVRNEYCGVPSLSICCWNPVQYACFGDSGGPLGSL 217
            .|      ..|.:|    .|...:||   |...|:       |:.|           :||..|..
  Fly   239 AAILPKRWTLYVLPPDQCRTKLRLSLLGRRHAHND-------SLLC-----------AGGDKGDF 285

  Fly   218 V--------------KYGHKTIYVQFGVTNSVTGNCDG---YSSYLDLMSYMPWL 255
            |              ..||...:...|:... |..|||   ...|.::..|..|:
  Fly   286 VCGDVDMTAVPLMCPLSGHDDRFHLAGLLTR-TARCDGPQLLGIYTNVKLYRQWI 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 37..258 CDD:238113 61/249 (24%)
CG9377NP_609640.1 PRK06406 <19..>80 CDD:235796
Tryp_SPc 105..339 CDD:214473 60/248 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.