DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30098 and Jon25Bi

Sequence 1:NP_725573.2 Gene:CG30098 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001033873.1 Gene:Jon25Bi FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster

Alignment Length:228 Identity:58/229 (25%)
Similarity:89/229 (39%) Gaps:66/229 (29%)


  Fly    60 CGGSLIAYRFVLTAAHCTKINDNLFVRLGEYDSSRTTDGQTRSYRVVSIYRHKNYIDFRNHDIAV 124
            ||||:||:.:||||||||.....:.:..|.  :.||....|.:.......::.|:.:...:|||:
  Fly    64 CGGSIIAHDWVLTAAHCTNGASQVTIYYGA--TWRTNAQFTHTVGSGDFIQNHNWPNQNGNDIAL 126

  Fly   125 LKL------------------DRQVVYDAYIRPICILLNSGLQSLANSIQNFTLTGWGQMAHYYK 171
            ::.                  ||..:||.|....|                    ||| :.....
  Fly   127 IRTPHVDFWHMVNKVELPSFNDRYNMYDNYWAVAC--------------------GWG-LTTAGS 170

  Fly   172 MPTTLQEMSLRRVRNEYC----GVPSLSICCWNPV--QYACFGDSGGPL-----GSLVKYGHKTI 225
            .|..::.:.|:.:.|..|    |.....|.|.:..  :..|.|||||||     |.||       
  Fly   171 QPDWMECVDLQIISNSECSRTYGTQPDGILCVSTSGGKSTCSGDSGGPLVLHDGGRLV------- 228

  Fly   226 YVQFGVTNSVTGN-CDG--YSSYLDLMSYMPWL 255
                |||:.|:|| |..  .|.:..:.:.:.|:
  Fly   229 ----GVTSWVSGNGCTAGLPSGFTRVTNQLDWI 257

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 57/226 (25%)
Tryp_SPc 37..258 CDD:238113 58/229 (25%)
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 58/227 (26%)
Tryp_SPc 37..260 CDD:238113 58/229 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C53123
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24260
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.