DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30098 and Jon25Biii

Sequence 1:NP_725573.2 Gene:CG30098 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_608881.1 Gene:Jon25Biii FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster

Alignment Length:286 Identity:74/287 (26%)
Similarity:109/287 (38%) Gaps:79/287 (28%)


  Fly    10 FLVILTLGSYGYSQLLDSKCI-------ALFRIRVIGGQNA--RRTPWMAYLIRDNRFACGGSLI 65
            ||.||.| :...:...|.|..       .....|:..|..|  .:.|:...|.....:.||||:|
  Fly     4 FLAILAL-AVASASAFDEKVFVKDLPKATKIEGRITNGYAAPEGKAPYTVGLGFSGGWWCGGSII 67

  Fly    66 AYRFVLTAAHCTKINDNLFVRLGEYDSSRTTDGQTRSYRVVSIYRHK----NYIDFRNHDIAVLK 126
            |:.:||||.||          :|:..|.....|.|  :|..:.:.|.    |:|...|.|||:::
  Fly    68 AHDWVLTAEHC----------IGDAASVIVYFGAT--WRTNAQFTHTVGNGNFIKHSNADIALIR 120

  Fly   127 L------------------DRQVVYDAYIRPICILLNSGLQSLANSIQNFTLTGWGQMAHYYKMP 173
            :                  ||...|:.:....|                    |||.......:|
  Fly   121 IPHVDFWHMVNKVELPSYNDRYNNYNEWWAVAC--------------------GWGGTYDGSPLP 165

  Fly   174 TTLQEMSLRRVRNEYCGVPSLS----ICCWNPV--QYACFGDSGGPLGSLVKYGHKTIYVQFGVT 232
            ..||.:.|:.|.||.||....|    :.|...|  :..|.|||||||  :...|.|.:    ||:
  Fly   166 DWLQCVDLQIVHNEECGWTYGSVGDNVICTRTVDGKSICGGDSGGPL--VTHDGSKLV----GVS 224

  Fly   233 NSVTGN-C-DGYSSYLDLMSY-MPWL 255
            |.|:.| | .|..:....::| :.|:
  Fly   225 NFVSSNGCQSGAPAGFQRVTYHLDWI 250

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 66/251 (26%)
Tryp_SPc 37..258 CDD:238113 66/253 (26%)
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 67/252 (27%)
Tryp_SPc 37..253 CDD:238113 66/253 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C53288
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24260
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.