DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30098 and CG14227

Sequence 1:NP_725573.2 Gene:CG30098 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_608345.2 Gene:CG14227 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster

Alignment Length:290 Identity:86/291 (30%)
Similarity:131/291 (45%) Gaps:51/291 (18%)


  Fly     7 LLTFLVILTLGS-YGYSQLLDSKCIALFRIRVIGGQ----NARRT--------------PWMAYL 52
            ||.....|.||| .|.:.|||::|          |:    ||:.|              ||:..:
  Fly     8 LLILFASLFLGSREGSAFLLDAEC----------GRSLPTNAKLTWWNYFDSSTDIQANPWIVSV 62

  Fly    53 IRDNRFACGGSLIAYRFVLTAAHCTKINDNLFVRLGEYDSSRTTDGQTRSYRVVSIY-------- 109
            |.:.:..|.||||.:|||||||||. ..:.:.|.||::|:.......:...|:.:.|        
  Fly    63 IVNGKAKCSGSLINHRFVLTAAHCV-FREAMQVHLGDFDAWNPGQNCSSGARLSNAYCVRIDKKI 126

  Fly   110 RHKNY--IDFRNHDIAVLKLDRQVVYDAYIRPICILLNSGLQSLANSIQNFTLTGWGQMAHYYK- 171
            .|..:  |..:.:||.:|::...|.|..::||||:|:|..:.    :|..|.||.||..|..:: 
  Fly   127 VHAGFGKIQAQQYDIGLLRMQHAVQYSDFVRPICLLINEPVA----AIDRFQLTVWGTTAEDFRS 187

  Fly   172 MPTTLQEMSLRRVRNEYC------GVPSLSICCWNPVQYACFGDSGGPLGSLVKYGHKTIYVQFG 230
            :|..|:.....|:..|.|      .|....||......:||.||||||..:.:.||......|||
  Fly   188 IPRVLKHSVGDRIDRELCTLKFQQQVDESQICVHTETSHACKGDSGGPFSAKILYGGTYRTFQFG 252

  Fly   231 VTNSVTGNCDGYSSYLDLMSYMPWLYQTLL 260
            :......:|.|.|...::..||.|::..|:
  Fly   253 IIIFGLSSCAGLSVCTNVTFYMDWIWDALV 282

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 73/253 (29%)
Tryp_SPc 37..258 CDD:238113 74/256 (29%)
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 70/225 (31%)
Tryp_SPc 57..277 CDD:238113 70/225 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_133884
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.