DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30098 and CG31269

DIOPT Version :9

Sequence 1:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster


Alignment Length:293 Identity:86/293 - (29%)
Similarity:124/293 - (42%) Gaps:77/293 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AIVLLTFLVILTLGSYGYSQLLDSKCIALFRI-------------RVIGGQNARRTPWMAYLIR- 54
            |:|||..|        |.|.|:.   |...||             |:|||| |....:..|.|. 
  Fly     3 AVVLLILL--------GLSGLVS---ITAIRIKGNSTDGRFYKDQRIIGGQ-AAEDGFAPYQISL 55

  Fly    55 ---DNRFACGGSLIAYRFVLTAAHCTKINDNLFVR-LGEYDSSRTTDGQTRSYRVVSIYRHKNYI 115
               ....:|||::|...||||||||.   :|.|:. |.....:...:.....|.:.:|:.|.||.
  Fly    56 QGISGAHSCGGAIINETFVLTAAHCV---ENAFIPWLVVVTGTNKYNQPGGRYFLKAIHIHCNYD 117

  Fly   116 DFRNH-DIAVLKLDRQVVYDAYIRPI---CILLNSGLQSLANSIQNFTLTGWGQMAHYYKMPTTL 176
            :...| |||:|:|...:.:|...:||   .:.:..|        ....|||||....:...|..|
  Fly   118 NPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQPG--------DEVILTGWGSTVLWGTSPIDL 174

  Fly   177 QEMSLRRV----------RNEYCGVPSLSICCWNPV-QYACFGDSGGPLGS------LVKYG--- 221
            |.:.|:.|          .:|.|.|.  .||.::.: :.||.|||||||.|      ||.:|   
  Fly   175 QVLYLQYVPHRECKALLSNDEDCDVG--HICTFSRLGEGACHGDSGGPLVSNGYLVGLVNWGWPC 237

  Fly   222 -------HKTIY-VQFGVTNSVTGN--CDGYSS 244
                   |.::| .:..:.|.::||  |.|:||
  Fly   238 ATGVPDVHASVYFYRDWIRNVMSGNSKCTGFSS 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 75/248 (30%)
Tryp_SPc 37..258 CDD:238113 74/247 (30%)
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 68/231 (29%)
Tryp_SPc 38..258 CDD:238113 67/233 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.